KEGG   Mus musculus (mouse): 11923
Entry
11923             CDS       T01002                                 

Gene name
Neurod4, AI846749, ATH-3, Ato, Atoh3, MATH-, MATH-3, Math, Math3, bHLH, bHLHa4
Definition
(RefSeq) neurogenic differentiation 4
  KO
K09079  neurogenic differentiation factor 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11923 (Neurod4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    11923 (Neurod4)
SSDB
Motif
Pfam: Neuro_bHLH HLH CCDC106
Other DBs
NCBI-GeneID: 11923
NCBI-ProteinID: NP_001316418
MGI: 108055
Ensembl: ENSMUSG00000048015
UniProt: O09105 Q545C0
Position
10 D3; 10 77.81 cM
AA seq 330 aa
MAKMYMKSKDMVELVNTQSWMDKGLSSQNEMKEQERRPGSYGMLGTLTEEHDSIEEDEEE
EEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
TLLEKHEEKSSICDSTISVHSFNYQSPGLPSPPYGHMETHSLHLKPQPFKSLGDSFGSHP
PDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYNFMPHYTSASLSSGHVHSTPFQTG
TPRYDVPVDLSYDSYSHHSIGTQLNTIFSD
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcaaaaatgtatatgaaatccaaggacatggtggagctggtcaacacacaatcctgg
atggacaaaggtctgagctctcaaaatgagatgaaggagcaagagagaagaccgggctct
tatggaatgctcggaaccttaactgaagagcatgacagtattgaggaggatgaagaagag
gaagaagatggagataaacctaaaagaagaggtcccaagaaaaagaagatgactaaagct
cgccttgaaagattcagggctcgaagagtcaaggccaatgctagagaacggacccggatg
catggcctgaatgatgccttggataatcttaggagagtcatgccatgttactctaaaact
caaaagctttccaagatagagactcttcgactggcaaggaactacatctgggccttgtct
gaagtcctggagactggtcagacacttgaagggaagggatttgtagagatgctatgtaaa
ggtctctctcaacccacaagcaacctggttgctggatgcctccaactggggcctcaatct
accctcctggagaagcatgaggaaaaatcttcaatttgtgactctactatctctgtccac
agcttcaactatcagtctccagggctccccagccctccttatggccatatggaaacacat
tctctccatctcaagcctcaaccatttaagagtttgggtgactcttttgggagccatcca
cctgactgcagtacccccccttatgagggtccactcacaccacccctgagcattagtggc
aacttctccttaaagcaagacggctcccctgatttggaaaaatcctacaatttcatgcca
cattatacctctgcaagtctaagttcagggcatgtgcattcaactccctttcagactggc
actccccgctatgatgttcctgtagacctgagctatgattcctactcccaccatagcatt
ggaactcagctcaatacgatcttctctgattag

DBGET integrated database retrieval system