KEGG   Mus musculus (mouse): 11925
Entry
11925             CDS       T01002                                 

Gene name
Neurog3, Ato, Atoh5, Math4, Math4B, bHLH, bHLHa7, ng, ngn3
Definition
(RefSeq) neurogenin 3
  KO
K08028  neurogenin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    11925 (Neurog3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11925 (Neurog3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    11925 (Neurog3)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 11925
NCBI-ProteinID: NP_033849
MGI: 893591
Ensembl: ENSMUSG00000044312
UniProt: P70661 Q548G3
Position
10; 10 B4
AA seq 214 aa
MAPHPLDALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRDCSEAEVGDCRGTSRK
LRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQAG
NLSPTASLEEFPGLQVPSSPSYLLPGALVFSDFL
NT seq 645 nt   +upstreamnt  +downstreamnt
atggcgcctcatcccttggatgcgctcaccatccaagtgtccccagagacacaacaacct
tttcccggagcctcggaccacgaagtgctcagttccaattccaccccacctagccccact
ctcatacctagggactgctccgaagcagaagtgggtgactgccgagggacctcgaggaag
ctccgcgcccgacgcggagggcgcaacaggcccaagagcgagttggcactcagcaaacag
cgaagaagccggcgcaagaaggccaatgatcgggagcgcaatcgcatgcacaacctcaac
tcggcgctggatgcgctgcgcggtgtcctgcccaccttcccggatgacgccaaacttaca
aagatcgagaccctgcgcttcgcccacaactacatctgggcactgactcagacgctgcgc
atagcggaccacagcttctatggcccggagccccctgtgccctgtggagagctggggagc
cccggaggtggctccaacggggactggggctctatctactccccagtctcccaagcgggt
aacctgagccccacggcctcattggaggaattccctggcctgcaggtgcccagctcccca
tcctatctgctcccgggagcactggtgttctcagacttcttgtga

DBGET integrated database retrieval system