KEGG   Mus musculus (mouse): 11931Help
Entry
11931             CDS       T01002                                 

Gene name
Atp1b1, Atp4b, Atpb, Atpb-1, NKbeta1
Definition
(RefSeq) ATPase, Na+/K+ transporting, beta 1 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11931 (Atp1b1)
   04022 cGMP-PKG signaling pathway
    11931 (Atp1b1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11931 (Atp1b1)
   04918 Thyroid hormone synthesis
    11931 (Atp1b1)
   04919 Thyroid hormone signaling pathway
    11931 (Atp1b1)
   04925 Aldosterone synthesis and secretion
    11931 (Atp1b1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11931 (Atp1b1)
   04261 Adrenergic signaling in cardiomyocytes
    11931 (Atp1b1)
  09154 Digestive system
   04970 Salivary secretion
    11931 (Atp1b1)
   04971 Gastric acid secretion
    11931 (Atp1b1)
   04972 Pancreatic secretion
    11931 (Atp1b1)
   04976 Bile secretion
    11931 (Atp1b1)
   04973 Carbohydrate digestion and absorption
    11931 (Atp1b1)
   04974 Protein digestion and absorption
    11931 (Atp1b1)
   04978 Mineral absorption
    11931 (Atp1b1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11931 (Atp1b1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11931 (Atp1b1)
   04964 Proximal tubule bicarbonate reclamation
    11931 (Atp1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11931 (Atp1b1)
CD molecules [BR:mmu04090]
 Proteins
  11931 (Atp1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_K-ATPase
Motif
Other DBs
NCBI-GeneID: 11931
NCBI-ProteinID: NP_033851
MGI: 88108
Ensembl: ENSMUSG00000026576
Vega: OTTMUSG00000049860
UniProt: P14094 Q545P0 Q3TV47
Position
1 H2.2; 1 71.75 cM
AA seq 304 aa AA seqDB search
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDD
MIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKL
NRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFP
LQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKI
EIKS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcggaaaagccaaggaggaaggcagctggaagaaattcatctggaactcggag
aagaaggagtttttgggcaggaccggtggtagttggtttaagatccttctgttctacgtg
atattttatggctgcctggctggcatcttcatcgggaccatccaagtaatgctgctaacc
atcagtgaactgaagcccacataccaggaccgagtggccccgccaggattgacacagatt
ccccagatccagaagactgagatctccttccgtcctaatgaccccaagagctacgaggcc
tacgtgctaaacatcatcaggttcctggaaaagtacaaggattcagcccagaaggacgac
atgattttcgaggactgtggcaatgttcccagtgaacccaaggaacggggcgacatcaat
cacgaacgaggagagaggaaggtgtgcaggttcaagcttgactggctggggaactgctcc
ggtctcaatgatgactcttacggctacagagaggggaagccctgcatcattatcaagctc
aaccgagtgttgggcttcaaaccgaagcctcccaagaatgaatccttggagacttaccca
ctgatgatgaagtataatccaaatgtcctgcctgttcagtgcactggcaagagagatgaa
gataaggataaagtcgggaacatagagtactttgggatgggcggatactacggcttccct
ctgcagtattatccctactacggcaaactcctgcagcccaagtacctgcagcccctgctg
gccgtgcagttcaccaacctcaccgtggacactgaaatccgcgtcgagtgtaaggcgtat
ggtgagaacattgggtacagtgagaaagaccgttttcagggacgctttgatgtaaaaatt
gaaattaagagctga

DBGET integrated database retrieval system