KEGG   Mus musculus (mouse): 11932
Entry
11932             CDS       T01002                                 

Gene name
Atp1b2, Amog, Atpb-2
Definition
(RefSeq) ATPase, Na+/K+ transporting, beta 2 polypeptide
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04911  Insulin secretion
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04964  Proximal tubule bicarbonate reclamation
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu04974  Protein digestion and absorption
mmu04976  Bile secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11932 (Atp1b2)
   04022 cGMP-PKG signaling pathway
    11932 (Atp1b2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11932 (Atp1b2)
   04918 Thyroid hormone synthesis
    11932 (Atp1b2)
   04919 Thyroid hormone signaling pathway
    11932 (Atp1b2)
   04925 Aldosterone synthesis and secretion
    11932 (Atp1b2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11932 (Atp1b2)
   04261 Adrenergic signaling in cardiomyocytes
    11932 (Atp1b2)
  09154 Digestive system
   04970 Salivary secretion
    11932 (Atp1b2)
   04971 Gastric acid secretion
    11932 (Atp1b2)
   04972 Pancreatic secretion
    11932 (Atp1b2)
   04976 Bile secretion
    11932 (Atp1b2)
   04973 Carbohydrate digestion and absorption
    11932 (Atp1b2)
   04974 Protein digestion and absorption
    11932 (Atp1b2)
   04978 Mineral absorption
    11932 (Atp1b2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    11932 (Atp1b2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    11932 (Atp1b2)
   04964 Proximal tubule bicarbonate reclamation
    11932 (Atp1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11932 (Atp1b2)
CD molecules [BR:mmu04090]
 Proteins
  11932 (Atp1b2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 11932
NCBI-ProteinID: NP_038201
MGI: 88109
Ensembl: ENSMUSG00000041329
Vega: OTTMUSG00000005985
UniProt: P14231 Q3UR55
Position
11 B3; 11 42.86 cM
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWGQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGHFVMFPANGSIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgcggacgcaccagttcatggggcgcaccgggaccagctgggccttcatc
ctcctcttctacctcgtcttctatggtttcctcacggccatgttcagcctcaccatgtgg
gtaatgctgcagaccgtctctgaccatacccccaagtaccaggatcgactggccacacca
ggcttgatgattcgacccaagactgagaaccttgatgtcattgtcaacattagtgacact
gaaagctggggtcagcatgttcagaagctcaacaagttcttggaaccttacaacgactcc
atccaagcacagaagaatgatgtctgccgtccagggcgatattatgagcaacctgataat
ggggttctgaactacccaaaacgtgcctgccagttcaaccggacccaactgggcgattgc
tctggcattggggaccctacccactatggttacagcaccgggcagccctgtgtcttcatc
aaaatgaatcgggtcatcaacttctatgcaggggcaaaccagagcatgaatgtcacttgt
gttggcaagagagatgaagatgctgagaaccttggccactttgtcatgttccctgctaat
ggcagcattgatctgatgtactttccctactatggcaaaaagttccatgtaaactatact
cagcctttggtggctgtaaagttcctgaatgtgacccccaacgtggaggtgaatgttgaa
tgccgcatcaacgctgccaatattgccacagacgatgagcgggacaagttcgctggccgt
gtggccttcaaactccggatcaacaaaacctga

DBGET integrated database retrieval system