KEGG   Mus musculus (mouse): 11937
Entry
11937             CDS       T01002                                 

Gene name
Atp2a1, SER, SERCA1
Definition
(RefSeq) ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04919  Thyroid hormone signaling pathway
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11937 (Atp2a1)
   04024 cAMP signaling pathway
    11937 (Atp2a1)
   04022 cGMP-PKG signaling pathway
    11937 (Atp2a1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    11937 (Atp2a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11937 (Atp2a1)
   04261 Adrenergic signaling in cardiomyocytes
    11937 (Atp2a1)
  09154 Digestive system
   04972 Pancreatic secretion
    11937 (Atp2a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11937 (Atp2a1)
   05017 Spinocerebellar ataxia
    11937 (Atp2a1)
   05022 Pathways of neurodegeneration - multiple diseases
    11937 (Atp2a1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    11937 (Atp2a1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    11937 (Atp2a1)
   05414 Dilated cardiomyopathy
    11937 (Atp2a1)
   05415 Diabetic cardiomyopathy
    11937 (Atp2a1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     11937 (Atp2a1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD SAND
Other DBs
NCBI-GeneID: 11937
NCBI-ProteinID: NP_031530
MGI: 105058
Ensembl: ENSMUSG00000030730
Vega: OTTMUSG00000025329
UniProt: Q8R429
Position
7 F3; 7 69.04 cM
AA seq 994 aa
MEAAHSKSTEECLSYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGDVCSLNEFSITGSTYAPEGEVLKNDKPVRAGQYDGLVELATICALC
NDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTEVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSAKFMEYEMDLTFVGVVGML
DPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFSENEEVTDRAYTGREFDD
LPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFLYAEDGPHVSYHQLTHFMQCTEHNPEFDGLDCEVFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLR
ALDFTQWLMVLKISLPVIGLDELLKFIARNYLEG
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggaggccgcgcactccaagtccacagaggaatgtttgtcctatttcggggtgagcgag
accacaggccttaccccagaccaagttaagcgacatctggaaaaatacggccccaatgag
ctccctgctgaggaaggcaagtctctgtgggagttggtggtagagcagttcgaagacctg
cttgtgcggattcttctcctggctgcctgcatttcctttgtgctggcctggtttgaggaa
ggcgaagaaaccgtcactgcctttgtggaaccttttgtcattctcttgatcctcattgcc
aacgccattgtgggggtttggcaggaacggaatgcagagaacgctatcgaagcgctgaaa
gaatatgaacccgagatgggaaaggtctatcgggctgaccgaaagtcagtgcaaaggatc
aaggctcgggacatcgttcctggggacatcgtggaggtggccgttggggacaaagtccct
gcagacatccgcatcctctccatcaaatccaccaccctccgggtcgaccagtccatcctg
acaggagagtctgtgtctgtcatcaagcacacagaccctgtccctgacccccgagctgtc
aaccaggacaagaagaacatgctcttctcaggtaccaacatcgcagccggcaaggctgta
ggcatcgtggccaccactggtgtgagtactgagattggcaagatccgagaccagatggct
gccaccgagcaggacaagactccactgcagcagaagcttgacgagtttggggagcagctg
tccaaggtcatctctctcatctgtgtggctgtctggcttatcaacattggccacttcaac
gatcctgtccatgggggctcctggttccggggtgccatttactacttcaagattgctgtg
gccttggctgtggcggccatcccagaagggcttcctgctgtcatcaccacctgcttggct
ttgggtacccgccggatggcaaagaagaacgccatcgtgaggagtctgccctctgtggag
accctgggctgtacctctgtcatctgttctgacaaaacagggaccctcaccaccaaccag
atgtcagtttgcaagatgttcatcattgacaaggtggatggggatgtctgctcactgaac
gagttctccatcactggctctacttatgctcctgagggagaggtcttgaagaatgataag
ccagtccgagcagggcagtatgatgggctggtggagctcgctaccatctgtgccctctgc
aatgattcctccttggactttaatgagaccaaaggtgtctatgagaaggtgggcgaggcc
acggagactgctctcaccaccttggtggagaagatgaacgtattcaacacggaagtgaga
agcctctctaaagtggagcgggccaacgcctgcaattcggtgatccgccaactcatgaag
aaggaattcaccctggaattttcccgagacaggaagtctatgtctgtctactgttcacca
gctaagtcctcacgggctgccgtgggcaacaagatgtttgtcaagggtgcccccgagggg
gtcatcgaccgctgtaactatgtgcgtgttggcacgacccgtgtgccattgacaggcccc
gtgaaggagaagatcatgtctgtgatcaaggagtggggcactggtcgggacacactgcgg
tgcctggcgctggccacccgcgacacgccccccaaacgcgaggagatggttctggatgat
tcagccaagttcatggagtatgagatggacctgacgtttgttggtgttgtgggcatgttg
gatccaccccgcaaggaggtcacaggctctatccagctgtgtcgtgatgctgggatccga
gtgatcatgatcactggggacaacaagggtacagccattgccatctgccgacgaattggc
atcttttcggagaatgaggaagtgacagaccgtgcctacactggccgtgagtttgacgat
ctgcccctggccgagcagcgggaggcctgcagacgcgcctgctgctttgctcgtgtggag
ccctcacacaagtccaagattgtggagtacctgcagtcctacgatgagatcacagccatg
acaggggatggtgtcaatgatgcccctgctctgaagaaggccgagattggcattgccatg
ggatctggtactgctgtggctaagacggcctctgaaatggtactggccgatgataacttc
tccaccatcgtggctgccgtggaggaaggccgcgccatctacaacaacatgaagcagttc
atccgctacctcatctcctccaatgtgggcgaggtggtctgtatcttcttgacagcagcc
ttggggctgcctgaggctctgatccctgtgcagctgctctgggtgaacttggtgactgat
gggctcccggctactgccctgggattcaacccacctgacctggacatcatggaccgcccc
cccaggagtcccaaggagcctcttatcagtggctggctctttttccgctacatggcaatt
gggggctatgtgggtgcagccactgtaggagcagctgcctggtggtttttgtatgcagag
gacgggcctcatgtcagctaccatcagctgactcatttcatgcagtgcactgagcacaac
cctgaattcgatggcctggactgtgaggtctttgaggcccccgagcccatgaccatggcc
ttgtctgtgttggtgaccatcgagatgtgcaatgctctcaacagcctgtctgagaaccag
tccctactgcggatgccaccctgggtgaacatctggctgctgggttccatctgcctgtcc
atgtccctccacttcctcatcctctatgtcgaccccctgccgatgatcttcaagctccgg
gccctggactttacccagtggctcatggtcctcaagatctcactgccagtcatcgggctg
gatgagcttctcaagttcattgctcggaactatctggagggataa

KEGG   Mus musculus (mouse): 11938
Entry
11938             CDS       T01002                                 

Gene name
Atp2a2, 9530097L16Rik, D5Wsu150, D5Wsu150e, SER, SERC, SERCA2, SERCA2B, Serca2a, mKIAA4195
Definition
(RefSeq) ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04919  Thyroid hormone signaling pathway
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11938 (Atp2a2)
   04024 cAMP signaling pathway
    11938 (Atp2a2)
   04022 cGMP-PKG signaling pathway
    11938 (Atp2a2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    11938 (Atp2a2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    11938 (Atp2a2)
   04261 Adrenergic signaling in cardiomyocytes
    11938 (Atp2a2)
  09154 Digestive system
   04972 Pancreatic secretion
    11938 (Atp2a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11938 (Atp2a2)
   05017 Spinocerebellar ataxia
    11938 (Atp2a2)
   05022 Pathways of neurodegeneration - multiple diseases
    11938 (Atp2a2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    11938 (Atp2a2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    11938 (Atp2a2)
   05414 Dilated cardiomyopathy
    11938 (Atp2a2)
   05415 Diabetic cardiomyopathy
    11938 (Atp2a2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     11938 (Atp2a2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 11938
NCBI-ProteinID: NP_001103610
MGI: 88110
Ensembl: ENSMUSG00000029467
Vega: OTTMUSG00000054516
UniProt: O55143 Q5DTI2
Position
5 62.38 cM; 5 F
AA seq 1044 aa
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDTCSLNEFSITGSTYAPIGEVQKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTPGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLKREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
SPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFDGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNLTQWLMVLKISLPVILMDETLKFVARNYLEQPGKECVQPATKSSCSLSACTDGISWPF
VLLIMPLVVWVYSTDTNFSDMFWS
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggagaacgctcacacaaagaccgtggaggaggtgctgggccacttcggggtcaacgag
agcacggggctgagcttggagcaggtcaagaagctcaaggagagatggggctccaacgaa
ttgccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagactta
ctagttagaattttactgctggcagcatgtatatctttcgttttggcttggttcgaggaa
ggggaagaaacgattacagcctttgtagagccgtttgtaattctgcttatcttggtagcc
aatgcaatcgtgggtgtgtggcaggaaagaaatgctgaaaatgcaatagaagctcttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtgcaacgaatt
aaagctaaagacatagttcctggtgatatagtggaaattgctgttggtgacaaagttcct
gctgatattagattgacatccatcaagtctacaactctaagagtcgaccagtcaattctt
acaggtgaatctgtctccgtcatcaagcatactgaccctgtccctgacccccgagctgtt
aatcaagacaaaaagaacatgctcttttctggtacaaacattgctgctgggaaagctatg
ggagtggtggtggcaactggagttaatactgagatcggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacacccctacagcagaagctagacgagtttggggagcagctt
tccaaagttatctccctcatttgcattgcagtctggatcatcaacattgggcatttcaat
gacccagttcatggtggctcctggatcaggggtgccatctactactttaagattgccgtg
gccctggctgttgccgcaatccctgagggtctgcctgctgtcatcaccacctgcttagct
cttggaactcgtaggatggcaaagaaaaatgctatcgttcgaagtctgccttctgtggag
acccttggttgtacttctgttatctgctcagataagacaggcacacttaccacaaaccag
atgtccgtgtgcaggatgttcattctggacaaagtagaaggtgacacttgttcccttaat
gagttcagcataactggatccacatatgcaccaattggagaagtgcaaaaggatgataag
ccagtgaagtgccatcagtatgacgggcttgtagagttagccaccatctgtgctctgtgt
aatgactctgctttggattataatgaggcaaagggtgtgtatgagaaagttggagaagct
accgagactgctctcacgtgcctggtggagaagatgaatgtatttgatactgagctgaag
gggctttctaaaatagagcgtgcaaacgcctgcaactcggtcataaagcagctgatgaag
aaggagttcactctggagttttcacgggatagaaaatcaatgtccgtctattgtacccca
aacaagccaagccggacatccatgagcaagatgtttgtgaagggggctccagaaggtgtc
atcgataggtgcacccacatccgagttggaagtaccaaggtccccatgactcctggtgtc
aaacagaagattatgtctgtcattcgggagtggggcagtggcagcgacacgctacggtgc
ctggctctggccactcatgacaacccactgaagagagaggagatgcacctggaagactct
gctaacttcatcaaatacgagaccaacctgactttcgtcggctgtgtgggcatgctggat
cctcccaggattgaagtagcctcttctgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcactggagacaacaaaggcaccgctgtggccatctgtcgccgcattggcatc
tttgggcaggatgaggatgtgacatcaaaggcttttacagggcgagagtttgatgaatta
agcccttcagcccagagagatgcctgcttaaatgcccgctgttttgctcgagttgaacct
tcccacaagtctaagattgttgagttccttcagtcctttgatgagatcacagctatgact
ggtgatggtgtgaatgatgctcctgctctgaagaaatctgaaatcgggattgccatgggc
tcagggactgcagtggctaagactgcttctgagatggtcctggcagatgacaacttctcc
accattgtggctgctgttgaggaggggcgagccatctacaacaacatgaagcagttcatc
cgctacctcatctcatccaacgtgggggaagtggtctgtatcttcctgacggcagccctt
gggtttcctgaggctttaattcctgtccagttactctgggtcaatctggtgacagatggt
ctgcctgccactgcgctggggttcaatcctccagacctggacatcatgaacaaacccccc
cggaacccaaaagaaccactgatcagcgggtggctctttttccgttacctggctattggc
tgttatgttggcgctgccaccgtgggtgctgctgcatggtggttcatcgctgctgacggc
ggtccaagagtctccttctaccagctgagtcatttcctacagtgtaaggaggacaaccca
gacttcgatggagtggattgtgcaatctttgagtccccatatccaatgacaatggcactt
tctgttctagtaaccatagagatgtgtaatgccctcaacagcttgtctgaaaaccagtct
ttgctgaggatgcccccctgggagaatatctggctcgtgggctccatctgcttgtccatg
tcacttcacttcttgatcctctacgtggaacctttgccgctcattttccagatcacaccg
ctgaatctgacccagtggctgatggtgctgaaaatctccttgcctgtgatcctcatggat
gagacgctcaagtttgtggcccgaaactacctggaacaacccggtaaagagtgtgtgcag
cctgccaccaaatcttcctgctccctgtcggcatgcaccgatggcatttcctggccgttt
gtgctgctcattatgcccctggtggtctgggtctacagcacagacactaactttagcgat
atgttctggtcttga

KEGG   Mus musculus (mouse): 53313
Entry
53313             CDS       T01002                                 

Gene name
Atp2a3, SERCA3b, Ser, Serca3
Definition
(RefSeq) ATPase, Ca++ transporting, ubiquitous
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04919  Thyroid hormone signaling pathway
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    53313 (Atp2a3)
   04024 cAMP signaling pathway
    53313 (Atp2a3)
   04022 cGMP-PKG signaling pathway
    53313 (Atp2a3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    53313 (Atp2a3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    53313 (Atp2a3)
   04261 Adrenergic signaling in cardiomyocytes
    53313 (Atp2a3)
  09154 Digestive system
   04972 Pancreatic secretion
    53313 (Atp2a3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    53313 (Atp2a3)
   05017 Spinocerebellar ataxia
    53313 (Atp2a3)
   05022 Pathways of neurodegeneration - multiple diseases
    53313 (Atp2a3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    53313 (Atp2a3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    53313 (Atp2a3)
   05414 Dilated cardiomyopathy
    53313 (Atp2a3)
   05415 Diabetic cardiomyopathy
    53313 (Atp2a3)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     53313 (Atp2a3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 53313
NCBI-ProteinID: NP_001156809
MGI: 1194503
Ensembl: ENSMUSG00000020788
Vega: OTTMUSG00000006323
UniProt: Q64518 E9Q559 Q3U1K2 Q3U6T4 Q8C213
Position
11; 11 B4
AA seq 1026 aa
MEEAHLLSAADVLRRFSVTAEGGLSLEQVTDARERYGPNELPTEEGKSLWELVVEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTDAIPDPRAVNQDKKNMLFSGTNIASGKALGVAVATGLQTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEAEAGTCRLHEFTISGTTYTPEGEVRQGEQPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRVERAGACNSVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRADPKVQGSKMFVKGAPESVIERCSSVRVGSRTAPLSTT
SREHILAKIRDWGSGSDTLRCLALATRDTPPRKEDMHLDDCSRFVQYETDLTFVGCVGML
DPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDD
LSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNPREALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDTEGPQVTFYQLRNFLKCSEDNPLFAGIDCKVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLGAVVMSMALHFLILLVPPLPLIFQVT
PLSGRQWGVVLQMSLPVILLDEALKYLSRNHMDGVLGTFMQARSRQLPTTSRTPYHTGLA
SWKKRT
NT seq 3081 nt   +upstreamnt  +downstreamnt
atggaggaggcgcacctgctctccgctgccgacgtgctgcgtcgcttctcggtgacagcc
gagggcggcttgagcctggagcaggtgaccgacgcgcgggagcgttacggccccaacgag
ctcccgaccgaggaagggaaatccctgtgggagctggtggtggagcagtttgaggacctc
ttggtgcgcatcctgctgctggcagctctggtttcctttgtcctggcctggttcgaggag
ggtgaggagaccacaacggccttcgtggagcccctggtcatcatgctaattctcgtggcc
aatgcgatcgtgggagtgtggcaggaacgcaacgcagagagtgcaattgaggccttgaag
gagtatgagcctgagatgggtaaggtgatccggtctgaccgcaagggtgtacagaggatc
cgagccagggacatcgtccctggggacattgtggaagtggcagtgggagacaaggtaccc
gctgacctccgtctcatcgagatcaagtccaccacacttcgagtggaccagtccatcctg
acaggggaatccgtgtctgtgacgaagcacacagatgccattccagacccccgagccgtg
aaccaggacaagaagaacatgctattttctggcaccaatattgcatcaggcaaagccctg
ggtgtggctgtggctacaggcctgcagacagagctgggcaagattcggagccagatggcg
gctgtggagcctgagcggacgccattgcagcgcaagctggatgaatttgggaggcagctg
tcccatgccatctctgtgatctgtgtggctgtgtgggtcatcaacatcggccactttgct
gacccggcccacggtggatcctggctccgtggtgcagtctactacttcaagatcgctgtg
gccctggctgtggctgctatccccgagggtctcccagcagtcatcactacatgcctggcc
ctgggcacaagacgtatggcacgtaagaatgccattgtgcggagcctgccttctgtggag
acgctgggctgcacctcggtcatctgctctgacaagacggggacgctcaccaccaatcag
atgtctgtctgcaggatgttcgtggtggctgaagcagaggcaggcacctgtcgtttgcat
gaattcaccatttcgggtaccacgtacaccccagagggcgaagtgaggcaaggggagcag
cctgtgcgctgtgggcagtttgatgggctagtggagctcgccaccatctgtgccctctgc
aatgattctgcgctggactacaatgaggccaagggtgtgtatgagaaggtaggagaggcc
acagagaccgccctgacttgcctggtagagaagatgaatgtgtttgacacagacctgaaa
ggactgtcgcgggtggagcgtgctggcgcctgcaactcagtcatcaagcaactcatgcgg
aaagagttcaccctggagttctcccgggaccggaagtctatgtccgtgtactgcacacct
actcgtgctgaccccaaggtccagggcagcaagatgtttgtgaagggagctcctgagagt
gtaattgagcgctgtagctcagtccgagtgggcagccgaacagcacccctgagcaccact
tccagagagcatatcctggccaagatccgggactggggctcaggctctgacacactgcgc
tgcttagccttggccaccagggacacacccccaaggaaggaggacatgcatctagatgac
tgcagccggtttgtacagtacgagacagacctgaccttcgtgggctgcgtgggcatgtta
gacccaccgagaccagaggtggctgcttgtatcacacgctgttcccgggctggcattcga
gtggtcatgatcacaggggacaacaaagggacagctgtggccatctgccgccgacttggc
atctttggggacacggaggatgtgttgggcaaggcctacacgggccgtgagtttgatgac
ctcagcccagagcagcagcgccaggcttgtcgcactgcccggtgctttgcccgagtggaa
cccgcacataagtctcgaatcgtggagaacctacagtcctttaatgagatcactgccatg
actggcgatggggtgaatgatgcaccagccctgaagaaggcagagatcggcatcgccatg
ggctcaggcactgctgtggccaagtcagcagcagagatggtgctgtccgatgacaacttt
gcctccattgtggctgcagtagaagagggcagggccatctacaacaacatgaagcagttc
atccgctacctcatctcctccaatgttggcgaggttgtctgcatcttcctcacagcaatt
ctgggcctgcccgaagctctgatccctgtgcagctgctctgggtgaacctggtaacagat
ggcttaccggccacagcccttggcttcaacccaccagatctggatatcatggagaagccg
cctcggaatccccgtgaggccctcatcagtggctggctttttttccgctatttggctatt
ggagtgtatgtaggcctggctacagtggctgccgccacctggtggttcctgtatgacacc
gagggacctcaagtcaccttctatcagctgaggaacttcctgaagtgctctgaagacaat
ccactgtttgctggcattgactgcaaggtttttgagtcacgcttccccacaaccatggcc
ttatctgtgcttgtgaccattgaaatgtgcaacgccctcaacagcgtctctgagaaccag
tcactgctgcgcatgccaccctggctgaacccttggctgctgggggctgtggtcatgtcc
atggctctgcattttcttatcctcctggtgccacctctgcctctcatttttcaggtgacc
ccactgagtggtcggcagtggggggtggtgcttcagatgtctctgcctgtcatcctgctc
gatgaggccctcaagtatctgtccaggaatcacatggatggtgttctcgggacatttatg
caggctcggagtaggcagctgccgactacttccaggaccccataccacaccgggttggct
tcttggaaaaaaaggacctga

DBGET integrated database retrieval system