KEGG   Mus musculus (mouse): 11941
Entry
11941             CDS       T01002                                 

Gene name
Atp2b2, D6Abb2, D6Abb2e, Gena3, Gena300, PMC, PMCA2, Tmy, dfw, jo, jog, wm, wms, wri
Definition
(RefSeq) ATPase, Ca++ transporting, plasma membrane 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04925  Aldosterone synthesis and secretion
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    11941 (Atp2b2)
   04024 cAMP signaling pathway
    11941 (Atp2b2)
   04022 cGMP-PKG signaling pathway
    11941 (Atp2b2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    11941 (Atp2b2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11941 (Atp2b2)
  09154 Digestive system
   04970 Salivary secretion
    11941 (Atp2b2)
   04972 Pancreatic secretion
    11941 (Atp2b2)
   04978 Mineral absorption
    11941 (Atp2b2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    11941 (Atp2b2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     11941 (Atp2b2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 11941
NCBI-ProteinID: NP_001031761
MGI: 105368
Ensembl: ENSMUSG00000030302
Vega: OTTMUSG00000018967
UniProt: Q9R0K7 Q3UHH0 Q3UHJ3
Position
6 E3; 6 52.85 cM
AA seq 1198 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEA
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcaccatggaggagctgcgctccctcatggagctgcggggcacc
gaggctgtggtcaagatcaaggagacgtatggggacactgaagccatctgccggcgcctc
aaaacctcgcctgttgaaggtttaccaggcactgctccagacttggaaaagaggaaacag
atttttgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcgctacaggacgtgacacttatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccaccgggagagagcaatgaaggatgtgccacggcccagggtggg
gcagaggatgaaggtgaagcagaagcaggctggattgagggggctgccatcctgctgtca
gtcatctgtgtggtcctggtcacagccttcaatgactggagtaaggagaaacagttccgg
ggcctgcagagccgaattgagcaggagcagaagttcactgtggtccgggccggccaggtg
gttcagatccctgtggccgagatcgtggtcggggacattgcccagatcaaatatggtgac
cttcttcccgctgatggcctcttcatccagggaaatgacctcaaaattgatgaaagctca
ctcacaggggaatctgaccaggtgcgcaagtctgtggataaggaccccatgttgctgtca
ggaacccatgtgatggagggctcaggacggatggtggttactgctgtgggtgtgaactct
cagactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgccatggagatgcagcctctgaagagtgca
gagggcggcgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaaactggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacagtgatcatcctggtactctacttcaccgtggacaccttcgtggtcaacaag
aagccatggctgacggaatgcacacccgtctacgtacagtactttgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattctgtgaagaaaatgatgaaggacaacaacctggtacgccacctggat
gcctgtgagaccatgggcaatgccacagccatctgctcagacaagacaggaacgctgacc
accaaccgcatgaccgtggtccaggcctatgtcggtgacgtccactacaaggagatcccc
gatcccagctccatcaatgccaagacgctggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatccttcccccagaaaaagagggagccctgccccggcaggtg
ggcaacaagacagagtgcggcctgctgggctttgtgctggacttgaggcaggactacgag
ccggtgcgcagccagatgccagaggagaagctgtataaggtgtacaccttcaactccgtg
cgcaagtccatgagcaccgtcatcaagatgcccgacgagagcttccgcatgtacagcaag
ggcgcctcggagattgtgctcaaaaagtgctgcaagatcctcagtggggcaggggaagcc
cgtgtcttccggccccgagacagggatgagatggttaagaaggtgattgagcccatggcc
tgtgacgggctccgtaccatctgcgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacgtgcatctgcgtggtgggcatc
gaagacccagtacgacctgaggtcccagaagccatccgcaagtgccagcgggcaggtatc
acagtccgcatggtcaccggtgacaatatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
attcgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgctcctcgcccacggataagcacacgctggtcaaaggcatcatcgac
agtacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgacggg
cctgctctcaagaaggcagatgtgggcttcgcaatgggcatcgcaggcacagatgtggcc
aaggaggcctcagacatcatcctgacagatgacaacttcagcagcatcgtcaaggcagtg
atgtggggccgtaacgtctatgacagcatatccaaattcctgcagttccagctgactgtc
aacgtggtggcggtgatcgtggccttcacgggcgcctgcattacacaggactcccctctc
aaggctgtgcagatgctctgggtgaacctcatcatggacacgtttgcctccctggccctg
gccacagagccacctacggagactctgcttctgaggaaaccgtacggtcgcaacaagccg
ctcatctcgaggaccatgatgaagaacatcctgggccacgccgtctaccagctcaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagatcgacagcggaaggaacgcc
ccgctgcactcaccaccctcagagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgcaagatccacggcgagcgcaacgtctttgacggg
atcttccggaaccccatcttctgcaccatcgttcttggcactttcgccatccagatagtg
atcgtgcagtttggcgggaagcccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcatcgccaccatccct
accagcaggctcaagttcctgaaagaggcagggcgtctaacacagaaggaggagatcccc
gaggaggagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccgt
ggccagatcctgtggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

DBGET integrated database retrieval system