KEGG   Mus musculus (mouse): 11946
Entry
11946             CDS       T01002                                 

Gene name
Atp5a1, AI035633, AL022851, AL023067, At, Atp5f1a, Atpm, D18Ertd206, D18Ertd206e, Mom, Mom2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11946 (Atp5a1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11946 (Atp5a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11946 (Atp5a1)
   05012 Parkinson disease
    11946 (Atp5a1)
   05014 Amyotrophic lateral sclerosis
    11946 (Atp5a1)
   05016 Huntington disease
    11946 (Atp5a1)
   05020 Prion disease
    11946 (Atp5a1)
   05022 Pathways of neurodegeneration - multiple diseases
    11946 (Atp5a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11946 (Atp5a1)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142
Other DBs
NCBI-GeneID: 11946
NCBI-ProteinID: NP_031531
MGI: 88115
Ensembl: ENSMUSG00000025428
Vega: OTTMUSG00000017510
UniProt: Q03265
Position
18 E3; 18 52.38 cM
AA seq 553 aa
MLSVRVAAAVARALPRRAGLVSKNALGSSFVGARNLHASNTRLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKL
KEIVTNFLAGFEP
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgctgtctgtgcgcgtcgccgcggccgtggcccgtgccctccctcgacgggcgggactg
gtctccaaaaatgctttggggtcatcctttgttggtgcaagaaatctccatgcctctaac
actcgacttcagaagactggcacagctgagatgtcctccattctcgaggagaggattctg
ggagctgacacgtctgttgacctggaggagactgggcgtgtgttaagcattggtgatggt
attgcgcgagtgcacgggctgaggaatgttcaagcagaggagatggtggaattctcttca
ggcttaaagggtatgtccctgaacttggaacccgacaatgttggagttgtcgtgtttggg
aatgacaagctaattaaagaaggagacgttgtgaagaggacaggcgccatcgtggatgtc
cccgttggcgaggagctgttgggccgtgtggttgacgccctcggtaatgctattgatgga
aagggtccaattggttccaagacccgcagacgagtgggcctgaaagcccctggaattatc
ccccgaatctctgtgcgggagccgatgcagaccggcatcaaggctgtggatagcctggtg
cccattggccggggtcagcgtgagctgattattggtgacagacagactgggaaaacatcg
attgccattgacacaatcatcaaccagaaacgtttcaacgatgggaccgacgagaagaag
aagctgtactgcatctacgtcgcgattggtcagaagcggtccactgtggctcagctggtg
aagagactgacggatgcggatgccatgaagtacaccatcgtggtgtcagccactgcctct
gacgctgccccgcttcagtacttggctccctactccggctgctccatgggagagtacttt
agagacaacggcaagcacgctttgatcatctatgacgatctatccaagcaggctgtcgct
taccgccagatgtctctgttgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactcccgcctgctggagagagcagccaagatgaacgattcctttggt
ggtggctctttgactgccttaccagtcattgaaacacaggctggtgatgtgtccgcttac
attccaacaaatgttatttccatcactgacggacagatcttcttggaaacagaattgttc
tataaaggcatccgccctgccattaatgtgggtttgtctgtgtcccgtgtcggatctgct
gcccaaaccagagccatgaagcaggtggcaggtaccatgaagctggagttggctcagtac
cgggaggtggctgcgtttgcccagtttggttctgatttggacgctgccactcaacagctc
ttgagtcgtggtgtgcgtctgaccgagttgctaaagcaaggacagtactctcccatggct
attgaagaacaggtggctgttatctatgcgggtgtacggggttatcttgacaaactggag
cccagcaagatcacaaagtttgagaatgctttcttgtctcacgttatcagccagcaccag
tccctcttgggcaatatcaggtctgatgggaaaatctcagaacagtcagacgcaaagctc
aaagagattgtaacaaacttcttggctgggtttgaaccataa

KEGG   Mus musculus (mouse): 11947
Entry
11947             CDS       T01002                                 

Gene name
Atp5b, Atp5f1b
Definition
(RefSeq) ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11947 (Atp5b)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11947 (Atp5b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11947 (Atp5b)
   05012 Parkinson disease
    11947 (Atp5b)
   05014 Amyotrophic lateral sclerosis
    11947 (Atp5b)
   05016 Huntington disease
    11947 (Atp5b)
   05020 Prion disease
    11947 (Atp5b)
   05022 Pathways of neurodegeneration - multiple diseases
    11947 (Atp5b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11947 (Atp5b)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     11947 (Atp5b)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 RsgA_GTPase NB-ARC ATPase NACHT AAA_19 AAA_16 ABC_tran DUF2075
Other DBs
NCBI-GeneID: 11947
NCBI-ProteinID: NP_058054
MGI: 107801
Ensembl: ENSMUSG00000025393
Vega: OTTMUSG00000023688
UniProt: P56480
Position
10; 10 D3
AA seq 529 aa
MLSLVGRVASASASGALRGLSPSAALPQAQLLLRAAPAGVHPARDYAAQASAAPKAGTAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRDSRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFIEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgttgagtcttgtggggcgtgtggcctcggcctcggcctccggggccttgcggggactc
agcccttcggcggctctgccacaggcgcagcttctactgcgagctgctcccgccggggtt
catcctgccagagactatgcggcgcaggcgtctgcggccccgaaggcaggcactgccacc
gggcgaatcgtggcagtcatcggcgctgtggtggacgtccagttcgatgagggattacca
cccatcctaaatgccctggaagtgcaaggcagggacagcagactggttttggaggtggcc
cagcatttgggggagagcacggtcagaactattgctatggatggcactgaaggcttggtt
agaggccagaaagtactggattcaggggcaccaatcaaaattcctgttggtcctgagacc
ttgggcagaatcatgaatgtcattggagaacctattgatgagagaggtcctatcaaaacc
aaacaatttgctcctattcatgctgaggctcctgagttcatagagatgagtgttgagcag
gagattctggtgactgggataaaggttgtggatctgctggccccatacgccaagggtggg
aaaatcggactctttggaggtgctggcgttggaaagacagtactgatcatggagctaatc
aacaatgtcgccaaagcccatggtggttactctgtatttgctggtgttggtgagaggacc
cgtgagggcaatgatttataccatgaaatgattgaatctggtgttatcaatctaaaagat
gccacttccaaggtagcgttggtatatggacagatgaacgaaccacctggcgctcgagcc
cgggtagctctgactggtttgaccgttgctgaatacttcagagaccaggagggccaagat
gtcctgctgtttattgacaacatcttccgctttacccaggctggctcagaggtgtctgcc
ttattgggcagaatcccttctgctgtaggctaccagcccaccctagccaccgacatgggc
acaatgcaggaaaggatcaccaccaccaagaagggatcgatcacctcggtgcaggctatc
tatgtgcctgctgatgacctgactgaccctgcccctgcaaccacctttgcccatttggat
gctaccactgtgttgtcccgggctattgctgagttgggcatctatccagctgtggatcca
ctggactccacctctcgaattatggatcccaacattgttggcaatgagcattatgacgtc
gcccgaggagtgcagaaaatcctgcaggactacaaatctctccaggacatcattgccatc
ttgggtatggatgaactttctgaggaagataaattgactgtgtcccgggcaagaaagata
cagcgcttcttgtctcagccattccaagttgctgaggtcttcacgggtcacatggggaag
ctggtgcccttgaaggagaccattaaaggattccagcagattttagcaggtgaatatgac
catctcccagaacaagccttctacatggtgggacccattgaagaagccgtggcaaaggct
gataagctggcagaagagcacgggtcgtga

KEGG   Mus musculus (mouse): 11949
Entry
11949             CDS       T01002                                 

Gene name
Atp5c1, 1700094F02Rik, Atp5f1c
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11949 (Atp5c1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11949 (Atp5c1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11949 (Atp5c1)
   05012 Parkinson disease
    11949 (Atp5c1)
   05014 Amyotrophic lateral sclerosis
    11949 (Atp5c1)
   05016 Huntington disease
    11949 (Atp5c1)
   05020 Prion disease
    11949 (Atp5c1)
   05022 Pathways of neurodegeneration - multiple diseases
    11949 (Atp5c1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11949 (Atp5c1)
SSDB
Motif
Pfam: ATP-synt ACT_4
Other DBs
NCBI-GeneID: 11949
NCBI-ProteinID: NP_065640
MGI: 1261437
Ensembl: ENSMUSG00000025781
Vega: OTTMUSG00000011013
UniProt: Q91VR2 Q3UD06
Position
2; 2 A1
AA seq 298 aa
MFSRASVVGLSACAVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARVYGTGSLALYEKADIKAPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKNEVAA
LTAAGKEVMIVGVGEKIKGILYRTHSDQFLVSFKDVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNQFKSVISYKTEEKPIFSLNTIATAETMSIYDDIDADVLQNYQEYNLANLIYY
SLKESTTSEQSARMTAMDNASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt   +upstreamnt  +downstreamnt
atgttctcgcgggcgagcgttgtcgggctgtcggcctgcgccgtgcagccgcaatggatc
caagttcgaaacatggcaactctgaaagatattaccaggagactgaagtccatcaaaaac
atccagaaaattaccaagtctatgaagatggtggcagctgcaaagtatgcccgggctgag
cgggagctgaagcctgcccgagtgtatgggacaggttctttggctctgtatgagaaggct
gatattaaggcacctgaggacaagaagaagcacctcattattggtgtgtcctcagataga
gggctttgtggtgctattcactcctcagtggctaaacagatgaagaatgaagtggctgcc
ctcacagcagctgggaaagaagttatgattgttggagttggtgaaaaaatcaagggcata
ctttataggactcattctgatcagtttttggtgtcattcaaagatgtgggacggaagcct
cctacttttggagatgcatcagtcattgcccttgagttgttaaattctggatatgaattt
gatgaaggctctatcatttttaatcagttcaagtctgttatctcctacaagacagaagag
aagcccatcttctctctgaataccattgcgactgctgagaccatgagcatctatgatgac
attgatgctgatgtgctgcagaattaccaggagtacaatctggccaacctcatctactac
tccctgaaggagtccaccaccagtgagcagagtgccaggatgaccgccatggacaacgcc
agcaagaacgcttctgatatgattgacaaattgaccttgactttcaaccgcacccgccag
gctgtcatcacaaaggagttgattgaaatcatctctggggctgctgctctggattaa

KEGG   Mus musculus (mouse): 11950
Entry
11950             CDS       T01002                                 

Gene name
Atp5pb, Atp5, Atp5f1, C76477
Definition
(RefSeq) ATP synthase peripheral stalk-membrane subunit b
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11950 (Atp5pb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11950 (Atp5pb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11950 (Atp5pb)
   05012 Parkinson disease
    11950 (Atp5pb)
   05014 Amyotrophic lateral sclerosis
    11950 (Atp5pb)
   05016 Huntington disease
    11950 (Atp5pb)
   05020 Prion disease
    11950 (Atp5pb)
   05022 Pathways of neurodegeneration - multiple diseases
    11950 (Atp5pb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11950 (Atp5pb)
SSDB
Motif
Pfam: Mt_ATP-synt_B TraQ DUF2105 zf-RING_9
Other DBs
NCBI-GeneID: 11950
NCBI-ProteinID: NP_033855
MGI: 1100495
Ensembl: ENSMUSG00000000563
Vega: OTTMUSG00000027098
UniProt: Q9CQQ7 Q5I0W0
Position
3 F2.2; 3 46.46 cM
AA seq 256 aa
MLSRVVLSAAATAAPCLKNAAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGKVRLGLIP
EEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASF
GEFIDKLNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEV
TYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCI
EDLKLLAKKAQAQPIM
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctgtcccgggtggtgctttctgctgccgccacagcggccccgtgtctgaagaacgcg
gccgccctaggtccaggggtattacaggcaacaagggcctttcacacaggacagcctcgc
cttgcccctctaccacctcttcctgaatatggaggaaaagtgcgtcttgggctgattcct
gaggaatttttccagttcctttaccctaagactggtgtaacaggaccttatgtgcttgga
actggacttagcttgtattttctatccaaagaaatatatgtgattaccccagagaccttc
tctaccatatcagtagtagggttgatagtctatgtgattaagaaatatggcgcctctttt
ggagaatttattgacaaacttaatgaggaaaaaattgctcaactagaagaagtaaagcag
tcgagcatgaaacaaatccaggatgcaatcgacatggagaaggcacagcaggcactggtt
cagaagcgccattacctcttcgatgtgcagaggaataacattgccctggccttggaggtc
acttaccgggaacggctacataaagcatataaggaggtaaagaatcgcctggactaccac
atctctgtacagaacatgatgcgtcgcaaggaggaagaacacatgatagactgggtagaa
aagcatgtggtgaagagcatttctgtacagcaggaaaaggagaccattgccaagtgcatt
gaagatctaaagctgcttgcaaagaaggctcaagctcagccaattatgtga

KEGG   Mus musculus (mouse): 11951
Entry
11951             CDS       T01002                                 

Gene name
Atp5g1, Atp5mc1
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9)
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11951 (Atp5g1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11951 (Atp5g1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11951 (Atp5g1)
   05012 Parkinson disease
    11951 (Atp5g1)
   05014 Amyotrophic lateral sclerosis
    11951 (Atp5g1)
   05016 Huntington disease
    11951 (Atp5g1)
   05020 Prion disease
    11951 (Atp5g1)
   05022 Pathways of neurodegeneration - multiple diseases
    11951 (Atp5g1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11951 (Atp5g1)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 11951
NCBI-ProteinID: NP_001154891
MGI: 107653
Ensembl: ENSMUSG00000006057
Vega: OTTMUSG00000006275
UniProt: Q9CR84
Position
11; 11 D
AA seq 136 aa
MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQVARREFQTSVIS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcagaccaccaaggcactgctcatttctccagctctgattcgctcctgtaccaggggt
ctaatcaggcctgtgtctgcctccctcctgagcagaccagaggccccatctaagcagcct
tcctgcagcagctcccctctccaggtggcccgacgggaattccagaccagtgtcatttcc
cgggacatcgacacagcagccaagttcattggtgctggggccgccacagttggtgtggct
ggatcaggagctggcattggcacagtgtttggtagcttgattattggctatgccaggaac
ccatctctcaagcagcagctcttctcctatgccattctggggtttgccctgtctgaggcc
atgggactcttctgtttgatggtcgccttcctcatcctcttcgccatgtga

KEGG   Mus musculus (mouse): 11957
Entry
11957             CDS       T01002                                 

Gene name
Atp5j, Atp5pf, CF6
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11957 (Atp5j)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11957 (Atp5j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11957 (Atp5j)
   05012 Parkinson disease
    11957 (Atp5j)
   05014 Amyotrophic lateral sclerosis
    11957 (Atp5j)
   05016 Huntington disease
    11957 (Atp5j)
   05020 Prion disease
    11957 (Atp5j)
   05022 Pathways of neurodegeneration - multiple diseases
    11957 (Atp5j)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11957 (Atp5j)
SSDB
Motif
Pfam: ATP-synt_F6 RICH
Other DBs
NCBI-GeneID: 11957
NCBI-ProteinID: NP_001289142
MGI: 107777
Ensembl: ENSMUSG00000022890
Vega: OTTMUSG00000025153
UniProt: P97450
Position
16; 16 C3.3
AA seq 108 aa
MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGP
VDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS
NT seq 327 nt   +upstreamnt  +downstreamnt
atggttctgcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcat
ttgaagaggaacattggtgttacagctgtggcctttaataaggaacttgatcctgtacag
aaactcttcgtggacaagataagagagtacaaatcaaagcgacaggcatctggaggacct
gttgatattggcccagagtatcagcaagatctggacagagagctttataagcttaaacaa
atgtatggtaaaggagagatggatacatttcctaccttcaaatttgatgatcccaaattt
gaagtcatcgacaaaccccagtcctga

KEGG   Mus musculus (mouse): 17705
Entry
17705             CDS       T01002                                 

Gene name
ATP6
Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17705 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    17705 (ATP6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17705 (ATP6)
   05012 Parkinson disease
    17705 (ATP6)
   05014 Amyotrophic lateral sclerosis
    17705 (ATP6)
   05016 Huntington disease
    17705 (ATP6)
   05020 Prion disease
    17705 (ATP6)
   05022 Pathways of neurodegeneration - multiple diseases
    17705 (ATP6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17705 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17705 (ATP6)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    17705 (ATP6)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 17705
NCBI-ProteinID: NP_904333
MGI: 99927
UniProt: P00848 Q7JCY9
Position
MT
AA seq 226 aa
MNENLFASFITPTMMGFPIVVAIIMFPSILFPSSKRLINNRLHSFQHWLVKLIIKQMMLI
HTPKGRTWTLMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVITGFRHK
LKSSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV
LMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaacgaaaatctatttgcctcattcattaccccaacaataataggattcccaatcgtt
gtagccatcattatatttccttcaatcctattcccatcctcaaaacgcctaatcaacaac
cgtctccattctttccaacactgactagttaaacttattatcaaacaaataatgctaatc
cacacaccaaaaggacgaacatgaaccctaataattgtttccctaatcatatttattgga
tcaacaaatctcctaggccttttaccacatacatttacacctactacccaactatccata
aatctaagtatagccattccactatgagctggagccgtaattacaggcttccgacacaaa
ctaaaaagctcacttgcccacttccttccacaaggaactccaatttcactaattccaata
cttattattattgaaacaattagcctatttattcaaccaatggcattagcagtccggctt
acagctaacattactgcaggacacttattaatacacctaatcggaggagctactctagta
ttaataaatattagcccaccaacagctaccattacatttattattttacttctactcaca
attctagaatttgcagtagcattaattcaagcctacgtattcaccctcctagtaagccta
tatctacatgataatacataa

KEGG   Mus musculus (mouse): 17706
Entry
17706             CDS       T01002                                 

Gene name
ATP8
Definition
(RefSeq) ATP synthase F0 subunit 8
  KO
K02125  F-type H+-transporting ATPase subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17706 (ATP8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    17706 (ATP8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17706 (ATP8)
   05012 Parkinson disease
    17706 (ATP8)
   05014 Amyotrophic lateral sclerosis
    17706 (ATP8)
   05016 Huntington disease
    17706 (ATP8)
   05020 Prion disease
    17706 (ATP8)
   05022 Pathways of neurodegeneration - multiple diseases
    17706 (ATP8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17706 (ATP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17706 (ATP8)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    17706 (ATP8)
SSDB
Motif
Pfam: ATP-synt_8
Other DBs
NCBI-GeneID: 17706
NCBI-ProteinID: NP_904332
MGI: 99926
UniProt: P03930 Q7JCZ0
Position
MT
AA seq 67 aa
MPQLDTSTWFITIISSMITLFILFQLKVSSQTFPLAPSPKSLTTMKVKTPWELKWTKIYL
PHSLPQQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atgccacaactagatacatcaacatgatttatcacaattatctcatcaataattacccta
tttatcttatttcaactaaaagtctcatcacaaacattcccactggcaccttcaccaaaa
tcactaacaaccataaaagtaaaaaccccttgagaattaaaatgaacgaaaatctatttg
cctcattcattaccccaacaataa

KEGG   Mus musculus (mouse): 228033
Entry
228033            CDS       T01002                                 

Gene name
Atp5g3, 6030447M23, Atp5mc3
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9)
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    228033 (Atp5g3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    228033 (Atp5g3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    228033 (Atp5g3)
   05012 Parkinson disease
    228033 (Atp5g3)
   05014 Amyotrophic lateral sclerosis
    228033 (Atp5g3)
   05016 Huntington disease
    228033 (Atp5g3)
   05020 Prion disease
    228033 (Atp5g3)
   05022 Pathways of neurodegeneration - multiple diseases
    228033 (Atp5g3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    228033 (Atp5g3)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 228033
NCBI-ProteinID: NP_001288650
MGI: 2442035
Ensembl: ENSMUSG00000018770
Vega: OTTMUSG00000013287
UniProt: P56384 Q14BC2
Position
2; 2 C3
AA seq 141 aa
MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQ
TSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt   +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcccgcacccccgctctgatccgagctggatccagagtt
gcatatagaccaatttctgcatcagtgttatctcggccagagactaggactggagagggc
tctacagtttttaatggggcccagaatggtgtgtgtcagctgatccgaagggagtttcag
accagtgtaatcagcagagacattgatactgctgccaaattcattggtgcaggtgctgca
acagtaggagttgctggttctggtgctggtattggaacagtctttggcagtcttatcatt
ggttatgccagaaacccttcactgaagcagcagctgttctcatatgctatcctgggattt
gccttgtctgaagctatgggtctcttttgtttgatggttgcgttcttgatcttgtttgcc
atgtaa

KEGG   Mus musculus (mouse): 28080
Entry
28080             CDS       T01002                                 

Gene name
Atp5o, ATPO, Atp5po, D12Wsu28, D12Wsu28e, OSCP
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
  KO
K02137  F-type H+-transporting ATPase subunit O
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    28080 (Atp5o)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    28080 (Atp5o)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    28080 (Atp5o)
   05012 Parkinson disease
    28080 (Atp5o)
   05014 Amyotrophic lateral sclerosis
    28080 (Atp5o)
   05016 Huntington disease
    28080 (Atp5o)
   05020 Prion disease
    28080 (Atp5o)
   05022 Pathways of neurodegeneration - multiple diseases
    28080 (Atp5o)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    28080 (Atp5o)
SSDB
Motif
Pfam: OSCP PGAP1
Other DBs
NCBI-GeneID: 28080
NCBI-ProteinID: NP_613063
MGI: 106341
Ensembl: ENSMUSG00000022956
Vega: OTTMUSG00000026954
UniProt: Q9DB20
Position
16; 16 C4
AA seq 213 aa
MAAPAASGLSRQVRSFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEK
ELLRVGQLLKDPKVSLAVLNPYIKRTVKVKSLNDITKREKFSPLTANLMNLLAENGRLGN
TQGIISAFSTIMSVHRGEVPCTVTTASPLDDAVLSELKTVLKSFLSPNQILKLEIKTDPS
IMGGMIVRIGEKYVDMSAKSKIQKLSKAMREML
NT seq 642 nt   +upstreamnt  +downstreamnt
atggccgcgcctgcagcgtccggactgtctcgacaggttcggagcttcagtacatctgtg
gtcaggccctttgccaagcttgtaaggccccctgttcaggtctacggcatcgaaggccgc
tatgcaaccgccctgtactctgctgcatctaaggagaagaagctggaccaggtggagaag
gagctgctgcgcgtagggcaactcctgaaggaccccaaagtgtctctggctgttctgaat
ccctacatcaagcgcaccgtcaaagtgaaaagcctaaatgacatcacgaaaagggaaaag
ttctccccgctgacggccaacctcatgaatttacttgctgaaaatggtcgcctaggcaac
acccagggtatcatctctgccttttccaccatcatgagtgtccaccgcggagaagtgcca
tgcacagtgaccacagcatctcctctagatgacgctgttctctctgagttaaagacggtg
ctgaagagcttcctgagtccaaaccaaatactgaaactggagatcaagactgacccgtca
atcatgggcgggatgattgtccgaattggggaaaagtacgttgatatgtctgcaaagagc
aagattcagaagctcagcaaggccatgcgggagatgctctga

KEGG   Mus musculus (mouse): 66043
Entry
66043             CDS       T01002                                 

Gene name
Atp5d, 0610008F14Rik, 1500000I11Rik, AA960090, AI876556, AU020773, Atp5f1d, C85518
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
  KO
K02134  F-type H+-transporting ATPase subunit delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66043 (Atp5d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    66043 (Atp5d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66043 (Atp5d)
   05012 Parkinson disease
    66043 (Atp5d)
   05014 Amyotrophic lateral sclerosis
    66043 (Atp5d)
   05016 Huntington disease
    66043 (Atp5d)
   05020 Prion disease
    66043 (Atp5d)
   05022 Pathways of neurodegeneration - multiple diseases
    66043 (Atp5d)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66043 (Atp5d)
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-GeneID: 66043
NCBI-ProteinID: NP_079589
MGI: 1913293
Ensembl: ENSMUSG00000003072
Vega: OTTMUSG00000000005
UniProt: Q9D3D9 Q4FK74
Position
10; 10 C1
AA seq 168 aa
MLPASLLRHPGLRRLMLQARTYAEAAAAPAPAAGPGQMSFTFASPTQVFFDSANVKQVDV
PTLTGAFGILASHVPTLQVLRPGLVVVHTEDGTTTKYFVSSGSVTVNADSSVQLLAEEAV
TLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEANEALVKALE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttgcccgcctcactgcttcgtcacccgggcctgcgccgcctgatgcttcaggcgcgt
acatacgccgaggccgccgctgcacctgcccccgccgccgggcccggacagatgtccttc
acctttgcctccccgacgcaggtgttctttgacagtgccaacgtcaagcaagtggacgtg
cctacgctgactggagcctttggcatcttggcatcccatgtccccacactacaggtccta
cggcctgggctggtagtggttcacacagaagacggcaccacgactaagtactttgtgagc
agcggctccgtcactgtgaatgccgactcctctgtgcagttactagctgaagaagctgtg
acactggacatgctggacctgggggcagcccgggccaacctggagaaggcgcagtcagaa
ctgtcaggtgcggcggacgaggcagcacgggctgagatccagatccgtattgaggccaat
gaagccctagtgaaggccctggagtag

KEGG   Mus musculus (mouse): 67126
Entry
67126             CDS       T01002                                 

Gene name
Atp5e, 2410043G19Rik, ATPE, AV000645, Atp5f1e
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67126 (Atp5e)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67126 (Atp5e)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67126 (Atp5e)
   05012 Parkinson disease
    67126 (Atp5e)
   05014 Amyotrophic lateral sclerosis
    67126 (Atp5e)
   05016 Huntington disease
    67126 (Atp5e)
   05020 Prion disease
    67126 (Atp5e)
   05022 Pathways of neurodegeneration - multiple diseases
    67126 (Atp5e)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67126 (Atp5e)
SSDB
Motif
Pfam: ATP-synt_Eps
Other DBs
NCBI-GeneID: 67126
NCBI-ProteinID: NP_080259
MGI: 1855697
Ensembl: ENSMUSG00000016252
Vega: OTTMUSG00000016513
UniProt: P56382 Q545F5
Position
2; 2 H4
AA seq 52 aa
MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIKIVKVSKKE
NT seq 159 nt   +upstreamnt  +downstreamnt
atggtggcgtactggcgacaggctggactcagctacatccggttttcccagatctgtgca
aaagcagtgagggatgccctgaagaccgagttcaaagcgaacgctgagaagacttcgggc
agcagcataaaaattgtgaaagtctcgaagaaggagtag

KEGG   Mus musculus (mouse): 67942
Entry
67942             CDS       T01002                                 

Gene name
Atp5g2, 1810041M08Rik, Atp5mc2
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67942 (Atp5g2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    67942 (Atp5g2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67942 (Atp5g2)
   05012 Parkinson disease
    67942 (Atp5g2)
   05014 Amyotrophic lateral sclerosis
    67942 (Atp5g2)
   05016 Huntington disease
    67942 (Atp5g2)
   05020 Prion disease
    67942 (Atp5g2)
   05022 Pathways of neurodegeneration - multiple diseases
    67942 (Atp5g2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67942 (Atp5g2)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 67942
NCBI-ProteinID: NP_080744
MGI: 1915192
Ensembl: ENSMUSG00000062683
Vega: OTTMUSG00000047926
UniProt: P56383
Position
15; 15 F3
AA seq 146 aa
MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIP
SRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSY
AILGFALSEAMGLFCLMVAFLILFAM
NT seq 441 nt   +upstreamnt  +downstreamnt
atgtacgcctgctccaagttcgtctctacccgctccctgatcaggagcacctctctcagg
agcacctctcagctgctgagtcgtccgctgtctgcagtggagttgaagcgaccacagatg
ccaacagatgagagcctcagcagcttggcggtccggcggcctctgacttcacttatccct
agccgcagtttccaaaccagcgccatttcaagggacatcgacacagctgccaagttcatt
ggagctggggctgcgacagttggggtggctggctctggggcagggattgggactgttttt
gggagtctcatcattggctatgccaggaacccttctctgaagcaacaactcttctcctac
gcgattctgggctttgccctctcagaggccatggggctcttttgcctaatggtggccttt
ctcatcctcttcgccatgtga

KEGG   Mus musculus (mouse): 71679
Entry
71679             CDS       T01002                                 

Gene name
Atp5h, 0610009D10Rik, Atp5pd
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit D
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    71679 (Atp5h)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    71679 (Atp5h)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    71679 (Atp5h)
   05012 Parkinson disease
    71679 (Atp5h)
   05014 Amyotrophic lateral sclerosis
    71679 (Atp5h)
   05016 Huntington disease
    71679 (Atp5h)
   05020 Prion disease
    71679 (Atp5h)
   05022 Pathways of neurodegeneration - multiple diseases
    71679 (Atp5h)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    71679 (Atp5h)
SSDB
Motif
Pfam: Mt_ATP-synt_D Cep57_CLD
Other DBs
NCBI-GeneID: 71679
NCBI-ProteinID: NP_082138
MGI: 1918929
Ensembl: ENSMUSG00000034566
Vega: OTTMUSG00000003445
UniProt: Q9DCX2
Position
11; 11 E2
AA seq 161 aa
MAGRKLALKTIDWVSFVEVMPQNQKAIGNALKSWNETFHARLASLSEKPPAIDWAYYRAN
VAKPGLVDDFEKKYNALKIPVPEDKYTALVDQEEKEDVKSCAEFVSGSQLRIQEYEKQLE
KMRNIIPFDQMTIDDLNEIFPETKLDKKKYPYWPHQPIENL
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggcgtaaacttgctctaaaaaccattgattgggtatcttttgtggaggtcatg
ccccaaaaccagaaggcaattggaaatgccctgaagtcctggaatgagaccttccacgcc
aggttggctagtctgtctgagaaaccacctgcgattgactgggcttactacagggccaat
gtggccaagcctggcttggtggatgattttgaaaagaagtataatgccctgaagattcct
gtgcctgaggataaatacacagccctggtggaccaggaggagaaggaggatgtgaagagc
tgtgctgagtttgtgtctggatcccagctcaggatccaggagtatgagaagcagctggag
aaaatgaggaacataattccctttgaccagatgaccattgatgacttgaatgagatcttc
ccagaaaccaagctggacaaaaagaagtacccgtactggccccaccagcccatcgagaac
ctgtga

DBGET integrated database retrieval system