KEGG   Mus musculus (mouse): 11949
Entry
11949             CDS       T01002                                 

Gene name
Atp5c1, 1700094F02Rik, Atp5f1c
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11949 (Atp5c1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11949 (Atp5c1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11949 (Atp5c1)
   05012 Parkinson disease
    11949 (Atp5c1)
   05014 Amyotrophic lateral sclerosis
    11949 (Atp5c1)
   05016 Huntington disease
    11949 (Atp5c1)
   05020 Prion disease
    11949 (Atp5c1)
   05022 Pathways of neurodegeneration - multiple diseases
    11949 (Atp5c1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11949 (Atp5c1)
SSDB
Motif
Pfam: ATP-synt ACT_4
Other DBs
NCBI-GeneID: 11949
NCBI-ProteinID: NP_065640
MGI: 1261437
Ensembl: ENSMUSG00000025781
Vega: OTTMUSG00000011013
UniProt: Q91VR2 Q3UD06
Position
2; 2 A1
AA seq 298 aa
MFSRASVVGLSACAVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARVYGTGSLALYEKADIKAPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKNEVAA
LTAAGKEVMIVGVGEKIKGILYRTHSDQFLVSFKDVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNQFKSVISYKTEEKPIFSLNTIATAETMSIYDDIDADVLQNYQEYNLANLIYY
SLKESTTSEQSARMTAMDNASKNASDMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt   +upstreamnt  +downstreamnt
atgttctcgcgggcgagcgttgtcgggctgtcggcctgcgccgtgcagccgcaatggatc
caagttcgaaacatggcaactctgaaagatattaccaggagactgaagtccatcaaaaac
atccagaaaattaccaagtctatgaagatggtggcagctgcaaagtatgcccgggctgag
cgggagctgaagcctgcccgagtgtatgggacaggttctttggctctgtatgagaaggct
gatattaaggcacctgaggacaagaagaagcacctcattattggtgtgtcctcagataga
gggctttgtggtgctattcactcctcagtggctaaacagatgaagaatgaagtggctgcc
ctcacagcagctgggaaagaagttatgattgttggagttggtgaaaaaatcaagggcata
ctttataggactcattctgatcagtttttggtgtcattcaaagatgtgggacggaagcct
cctacttttggagatgcatcagtcattgcccttgagttgttaaattctggatatgaattt
gatgaaggctctatcatttttaatcagttcaagtctgttatctcctacaagacagaagag
aagcccatcttctctctgaataccattgcgactgctgagaccatgagcatctatgatgac
attgatgctgatgtgctgcagaattaccaggagtacaatctggccaacctcatctactac
tccctgaaggagtccaccaccagtgagcagagtgccaggatgaccgccatggacaacgcc
agcaagaacgcttctgatatgattgacaaattgaccttgactttcaaccgcacccgccag
gctgtcatcacaaaggagttgattgaaatcatctctggggctgctgctctggattaa

DBGET integrated database retrieval system