KEGG   Mus musculus (mouse): 11950Help
Entry
11950             CDS       T01002                                 

Gene name
Atp5f1, Atp5pb, C76477
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11950 (Atp5f1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11950 (Atp5f1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11950 (Atp5f1)
   05012 Parkinson disease
    11950 (Atp5f1)
   05016 Huntington disease
    11950 (Atp5f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mt_ATP-synt_B TraQ FliE DUF2105
Motif
Other DBs
NCBI-GeneID: 11950
NCBI-ProteinID: NP_033855
MGI: 1100495
Ensembl: ENSMUSG00000000563
Vega: OTTMUSG00000027098
UniProt: Q9CQQ7 Q5I0W0
Position
3 F2.2; 3 46.46 cM
AA seq 256 aa AA seqDB search
MLSRVVLSAAATAAPCLKNAAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGKVRLGLIP
EEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASF
GEFIDKLNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEV
TYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCI
EDLKLLAKKAQAQPIM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggtggtgctttctgctgccgccacagcggccccgtgtctgaagaacgcg
gccgccctaggtccaggggtattacaggcaacaagggcctttcacacaggacagcctcgc
cttgcccctctaccacctcttcctgaatatggaggaaaagtgcgtcttgggctgattcct
gaggaatttttccagttcctttaccctaagactggtgtaacaggaccttatgtgcttgga
actggacttagcttgtattttctatccaaagaaatatatgtgattaccccagagaccttc
tctaccatatcagtagtagggttgatagtctatgtgattaagaaatatggcgcctctttt
ggagaatttattgacaaacttaatgaggaaaaaattgctcaactagaagaagtaaagcag
tcgagcatgaaacaaatccaggatgcaatcgacatggagaaggcacagcaggcactggtt
cagaagcgccattacctcttcgatgtgcagaggaataacattgccctggccttggaggtc
acttaccgggaacggctacataaagcatataaggaggtaaagaatcgcctggactaccac
atctctgtacagaacatgatgcgtcgcaaggaggaagaacacatgatagactgggtagaa
aagcatgtggtgaagagcatttctgtacagcaggaaaaggagaccattgccaagtgcatt
gaagatctaaagctgcttgcaaagaaggctcaagctcagccaattatgtga

DBGET integrated database retrieval system