KEGG   Mus musculus (house mouse): 11950
Entry
11950             CDS       T01002                                 
Symbol
Atp5pb, Atp5f1, C76477
Name
(RefSeq) ATP synthase peripheral stalk-membrane subunit b
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11950 (Atp5pb)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11950 (Atp5pb)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    11950 (Atp5pb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11950 (Atp5pb)
   05012 Parkinson disease
    11950 (Atp5pb)
   05014 Amyotrophic lateral sclerosis
    11950 (Atp5pb)
   05016 Huntington disease
    11950 (Atp5pb)
   05020 Prion disease
    11950 (Atp5pb)
   05022 Pathways of neurodegeneration - multiple diseases
    11950 (Atp5pb)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11950 (Atp5pb)
SSDB
Motif
Pfam: Mt_ATP-synt_B TraQ DUF2105 zf-RING_9
Other DBs
NCBI-GeneID: 11950
NCBI-ProteinID: NP_033855
MGI: 1100495
Ensembl: ENSMUSG00000000563
UniProt: Q9CQQ7 Q5I0W0
Position
3:complement(105850014..105866579)
AA seq 256 aa
MLSRVVLSAAATAAPCLKNAAALGPGVLQATRAFHTGQPRLAPLPPLPEYGGKVRLGLIP
EEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYVIKKYGASF
GEFIDKLNEEKIAQLEEVKQSSMKQIQDAIDMEKAQQALVQKRHYLFDVQRNNIALALEV
TYRERLHKAYKEVKNRLDYHISVQNMMRRKEEEHMIDWVEKHVVKSISVQQEKETIAKCI
EDLKLLAKKAQAQPIM
NT seq 771 nt   +upstreamnt  +downstreamnt
atgctgtcccgggtggtgctttctgctgccgccacagcggccccgtgtctgaagaacgcg
gccgccctaggtccaggggtattacaggcaacaagggcctttcacacaggacagcctcgc
cttgcccctctaccacctcttcctgaatatggaggaaaagtgcgtcttgggctgattcct
gaggaatttttccagttcctttaccctaagactggtgtaacaggaccttatgtgcttgga
actggacttagcttgtattttctatccaaagaaatatatgtgattaccccagagaccttc
tctaccatatcagtagtagggttgatagtctatgtgattaagaaatatggcgcctctttt
ggagaatttattgacaaacttaatgaggaaaaaattgctcaactagaagaagtaaagcag
tcgagcatgaaacaaatccaggatgcaatcgacatggagaaggcacagcaggcactggtt
cagaagcgccattacctcttcgatgtgcagaggaataacattgccctggccttggaggtc
acttaccgggaacggctacataaagcatataaggaggtaaagaatcgcctggactaccac
atctctgtacagaacatgatgcgtcgcaaggaggaagaacacatgatagactgggtagaa
aagcatgtggtgaagagcatttctgtacagcaggaaaaggagaccattgccaagtgcatt
gaagatctaaagctgcttgcaaagaaggctcaagctcagccaattatgtga

DBGET integrated database retrieval system