KEGG   Mus musculus (mouse): 11957Help
Entry
11957             CDS       T01002                                 

Gene name
Atp5j, Atp5pf, CF6
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11957 (Atp5j)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    11957 (Atp5j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11957 (Atp5j)
   05012 Parkinson disease
    11957 (Atp5j)
   05016 Huntington disease
    11957 (Atp5j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_F6 RICH
Motif
Other DBs
NCBI-GeneID: 11957
NCBI-ProteinID: NP_001289142
MGI: 107777
Ensembl: ENSMUSG00000022890
Vega: OTTMUSG00000025153
UniProt: P97450
Position
16; 16 C3.3
AA seq 108 aa AA seqDB search
MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGP
VDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcat
ttgaagaggaacattggtgttacagctgtggcctttaataaggaacttgatcctgtacag
aaactcttcgtggacaagataagagagtacaaatcaaagcgacaggcatctggaggacct
gttgatattggcccagagtatcagcaagatctggacagagagctttataagcttaaacaa
atgtatggtaaaggagagatggatacatttcctaccttcaaatttgatgatcccaaattt
gaagtcatcgacaaaccccagtcctga

DBGET integrated database retrieval system