KEGG   Mus musculus (mouse): 11972
Entry
11972             CDS       T01002                                 

Gene name
Atp6v0d1, AI267038, Ac39, Atp6d, P39, VATX, Vma6
Definition
(RefSeq) ATPase, H+ transporting, lysosomal V0 subunit D1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04145  Phagosome
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05152  Tuberculosis
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11972 (Atp6v0d1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11972 (Atp6v0d1)
   04142 Lysosome
    11972 (Atp6v0d1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11972 (Atp6v0d1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11972 (Atp6v0d1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11972 (Atp6v0d1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11972 (Atp6v0d1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    11972 (Atp6v0d1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11972 (Atp6v0d1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 11972
NCBI-ProteinID: NP_038505
MGI: 1201778
Ensembl: ENSMUSG00000013160
Vega: OTTMUSG00000032456
UniProt: P51863
Position
8; 8 D3
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctctatttcaacgtggacaatggctacttggagggattagtg
cgcggcctgaaggccggggtgctcagccaggcggactacctcaacctggtgcagtgcgag
acgctcgaggacttgaagctgcacctacagagtacagattatggcaacttcctggccaat
gaagcgtcacctctgacggtgtcagtcatcgatgacaagctcaaggagaagatggtagta
gagttccgccacatgagaaaccatgcttatgagccgctcgccagcttcctggacttcata
acttatagctacatgattgacaacgtgatcctgctaatcacaggcacactgcaccagcgt
tcaatagctgaacttgtgcccaagtgccatccgctaggcagctttgagcagatggaggct
gtgaacatcgcacagacacctgcagagctctacaatgccattctggtggacacacccctg
gcggcttttttccaggactgcatctcagagcaggaccttgatgagatgaacatcgagata
atccgaaatacgctttacaaggcctacttggagtccttctacaagttctgtactctgttg
ggtgggaccacagctgatgccatgtgtcctatcctagagtttgaagcagaccgccgcgct
ttcatcatcaccatcaactctttcggcacagagctgtccaaggaggaccgtgccaagctc
ttcccgcactgtggccggctctaccctgagggcttggctcagctggcgcgggctgatgac
tatgaacaggtcaagaatgtagctgattactacccggaatacaaactgctttttgagggt
gcaggtagcaatcctggagacaagaccctggaggaccggttttttgaacatgaggtgaag
ctaaacaagctggccttcctgaaccagttccattttggtgtcttttatgcctttgtgaag
cttaaggaacaggaatgtcgcaacatcgtatggattgctgagtgcattgcccagcgccat
cgcgccaagatcgacaactacatccccatcttttag

DBGET integrated database retrieval system