KEGG   Mus musculus (mouse): 11973
Entry
11973             CDS       T01002                                 

Gene name
Atp6v1e1, 2410029D23Rik, Atp, Atp6, Atp6e, Atp6e2, Atp6v1e, D6Ertd385, D6Ertd385e, Vma4, p31
Definition
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit E1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    11973 (Atp6v1e1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    11973 (Atp6v1e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    11973 (Atp6v1e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    11973 (Atp6v1e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11973 (Atp6v1e1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    11973 (Atp6v1e1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    11973 (Atp6v1e1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW
Other DBs
NCBI-GeneID: 11973
NCBI-ProteinID: NP_031536
MGI: 894326
Ensembl: ENSMUSG00000019210
Vega: OTTMUSG00000056828
UniProt: P50518
Position
6 F1; 6 57.01 cM
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgctcagcgatgcagatgtacagaagcagattaagcacatgatggctttcattgaa
caagaagccaatgagaaagcagaagaaatagatgcaaaggcagaagaagagttcaacatt
gagaaaggtcgccttgtgcaaacgcaaagactgaagattatggaatactacgagaagaaa
gaaaagcagattgagcagcagaagaaaattcagatgtccaacttgatgaatcaagcaagg
ctcaaagtcctcagagcaagggatgacctcatcactgatctgctaaatgaggcaaagcag
agactcagtaaggtggtaaaagatacgacccgttaccaagtgctgctggatgggctggtc
cttcagggcttgtaccagctgctggagcctcgaatgatcgtgcgttgcagaaaacaagat
ttccctttggtgaaggccgcagtacaaaaagcaatccctatgtataaaattgctaccaaa
aaggatgttgatgtccagattgaccaggaggcctacctgcctgaggaaatagctggtggc
gttgagatctataatggggatcgcaagataaaggtttccaacaccctggaaagccggctg
gacctgatagcccagcagatgatgccagaagtccgtggagccttgtttggtgcaaatgcc
aataggaagtttctggactga

DBGET integrated database retrieval system