KEGG   Mus musculus (mouse): 11981Help
Entry
11981             CDS       T01002                                 

Gene name
Atp9a, IIa
Definition
(RefSeq) ATPase, class II, type 9A
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    11981 (Atp9a)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     11981 (Atp9a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase E1-E2_ATPase Cation_ATPase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 11981
NCBI-ProteinID: NP_056546
MGI: 1330826
Ensembl: ENSMUSG00000027546
Vega: OTTMUSG00000016114
UniProt: O70228
Position
2; 2 H3
AA seq 1047 aa AA seqDB search
MTDSIPLQPVRHKKRVDSRPRAGCCEWLRCCGGGEPRPRTVWLGHPEKRDQRYPRNVINN
QKYNFFTFLPGVLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTIIRE
AVEEIRCYVRDKEMNSQVYSRLTSRGTVKVKSSNIQVGDLILVEKNQRVPADMIFLRTSE
KNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFLGTFT
REDSDPPISESLSIENTLWAGTVIASGTVVGVVLYTGRELRSVMNTSDPRSKIGLFDLEV
NCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSW
VIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGLDSMDE
VQSHIFSIYTQQSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTD
QAEAEKQFEDSCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQ
VFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLV
VAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVR
PTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFR
RKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLT
CAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSA
ALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKS
EVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTS
LILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVIT
LVSCLPLYVLKYLRRRFSPPSYSKLTS
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagcatcccgctgcagcccgtgcgccacaagaagcgggtggacagtaggccg
cgcgcggggtgctgtgagtggctgagatgttgcggtggaggggagcccaggccccgtact
gtctggttgggacaccccgagaagagggaccagcggtaccctcgaaatgtcatcaacaac
cagaagtacaatttcttcacatttcttcctggggtgttgttcagccagttcagatacttc
ttcaacttctacttcctgcttctcgcctgctcgcagttcgtcccagagatgaggcttggc
gccctgtacacctactgggttcctctgggcttcgtgctggctgtcaccatcatccgtgag
gcagtagaggagatccgatgttatgtgcgtgacaaggagatgaactcccaggtctacagc
cggctcacgtcacgagggaccgtgaaggtgaagagttcaaacatccaggtgggagacctc
atccttgtggaaaagaaccagcgggtccctgctgacatgatcttcctgaggacgtcagag
aaaaacggctcttgcttcttgcgcacggatcagctggatggagagacagactggaagctt
cggctcccggtggcctgcacacagaggcttcccacggctgctgacctcctgcagattcgg
tcctatgtgtacgctgaagagcccaacatcgacattcacaacttcctggggactttcacc
agggaagacagtgaccctccgatcagtgagagtctgagcattgagaacacgctgtgggcc
ggcaccgtcatagcatcaggcactgttgtaggcgttgttctctacactggcagagaactg
cggagtgtcatgaatacttccgaccccagaagtaagattggcctgttcgacctggaggtg
aactgcctcaccaagatcctgtttggtgcgctggtggtggtgtcgctggtcatggtggcc
ctgcagcactttgccggccgctggtacctgcagatcatccgcttcctgctcctgttttcc
aacatcattcctatcagcttgcgtgtgaacttggacatgggcaagatcgtgtacagctgg
gtgatccgcagggattccaaaatccccgggaccgtggttcgttccagcacaattcctgag
cagctgggcaggatttcgtacttgctcacagacaagacaggaaccctgacccagaatgag
atggtgttcaagcggctgcacctgggtacggtggcctacggcctggactccatggacgaa
gtgcagagtcacatcttcagcatttacacccagcaatcccaggatccacctgctcagaag
ggccccacggtcaccaccaaggttcggaggaccatgagcagccgtgtccacgaggctgtg
aaggccattgcactctgccacaacgtgacacccgtgtacgagtccaatggtgtgacggac
caggctgaggctgagaagcagtttgaggactcctgccgagtgtaccaggcatccagcccg
gatgaggtggctctggtccagtggacagaaagtgtgggactgacgctggtgggtcgagac
cagtcctccatgcagctgaggacccctggtgaccaggtcctgaatctcactatccttcag
gtcttcccgttcacctatgagagcaagcggatgggcatcatcgtgcgggatgagtccacg
ggggaaatcacgttctacatgaagggagcagacgtcgtcatggctggcattgtccagtac
aacgactggctggaggaggagtgtggcaacatggcccgggagggactacgtgtgctggtg
gtagccaagaagtccctcacagaggagcagtaccaagactttgaagcccgctacgtccag
gctaagctgagtgtgcatgaccgctcgctgaaggtggccacggtgatcgagagcctggag
atggagatggagctgctgtgcctgactggtgtggaggaccagctgcaggcagatgtcagg
cccacgctggagacgctgcgcaacgctggcatcaaggtttggatgctaacaggggacaag
ctggagacagccacgtgcacagccaagaacgcacatctggtgaccagaaaccaagatatc
catgttttccgactggtgaccaaccgcggggaggcccacctggagctgaatgccttccgt
aggaagcatgactgtgccctggtcatctctggagactccctggaggtttgcctcaaatac
tatgagtacgagttcatggaactggcctgccagtgcccggctgtggtgtgctgccgctgt
gccccaacccagaaggcccagattgttcggctgctccaggaacgcaccgggaagctcacc
tgtgcagtaggggacggaggcaatgacgtcagcatgatccaggaatccgactgcggcgtg
ggcgtggagggcaaggaagggaagcaggcctcgctggcagcggacttctccatcacccag
ttcaagcatctcggccgcttgctcatggtgcacggtcggaacagctacaagcgctcggcg
gccctcagtcagtttgtgatccacaggagcctctgcatcagcaccatgcaggctgtcttc
tcgtctgtgttctactttgcatccgttcctctctaccaaggcttcctgatcattgggtat
tctaccatctacacgatgtttcccgtgttctccctggttttggacaaagacgtgaagtcg
gaagtcgccatgttgtatcctgagctctacaaggacctgcttaaggggcggccactgtcc
tacaagacgttcttaatttgggtgttaatcagcatctatcaagggagcaccatcatgtac
ggggcgctgctgctgttcgagtcggagtttgtacacatcgtggcaatctccttcacatcc
ctcatcctcactgagctactgatggtggcgctcaccatccagacgtggcactggctcatg
acagtggccgagctactcagcctggcctgctacattgcctccctggtgttcctccatgag
ttcatcgatgtctacttcattgccaccctgtcattcctctggaaggtgtccgtcatcacc
ttggtcagctgtctccccctctatgtcctcaagtacctgcggagacggttctccccaccc
agctactcgaagctcacttcctaa

DBGET integrated database retrieval system