KEGG   Mus musculus (mouse): 11982
Entry
11982             CDS       T01002                                 

Symbol
Atp10a, Atp10c, pfatp
Name
(RefSeq) ATPase, class V, type 10A
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    11982 (Atp10a)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     11982 (Atp10a)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3 Rce1-like Retinin_C
Other DBs
NCBI-GeneID: 11982
NCBI-ProteinID: NP_033858
MGI: 1330809
Ensembl: ENSMUSG00000025324
Vega: OTTMUSG00000058914
UniProt: O54827 Q3V1Y7 Q6A046
Position
7:58305896..58479783
AA seq 1508 aa
MERELPAAEESASSGWRRPRRRRWEGRTRTVRSNLLPPLGTEDSTIGAPKGERLLMRGCI
QHLADNRLKTTKYTLLSFLPKNLFEQFHRLANVYFVFIALLNFVPAVNAFQPGLALAPVL
FILAVTAIKDLWEDYSRHRSDHEINHLGCLVFSREEKKYVNRYWKEIRVGDFVRLCCNEI
IPADILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEFNPLTFTSVIECEKP
NNDLSRFRGYIMHSNGEKAGLHKENLLLRGCTIRNTEAVAGIVIYAGHETKALLNNSGPR
YKRSQLERQMNCDVLWCVLLLVCISLFSAVGHGLWVRRYQEKKALFDVPESDGSSLSPAT
AAVYSFFTMIIVLQVLIPISLYVSIEIVKVCQVYFINQDIELYDEETDSQLQCRALNITE
DLGQIKYIFSDKTGTLTENKMVFRRCTVSGIEYSHDANAQRLARYQEADSEEEEVVSKVG
TISHRGSTGSHQSIWMTHKTQSIKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPK
LLEKVSECDRFLAIARHQEHPLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRQKVRVR
FELKSPVKTIEDFLRRFTPSRLASGCSSIGNLSTSKSSHKSGSAFLPSLSQDSMLLGLEE
KLGQTAPSIASNGYASQAGQEESWASECTTDQKCPGEQREQQEGELRYEAESPDEAALVY
AARAYNCALVDRLHDQVSVELPHLGRLTFELLHTLGFDSIRKRMSVVIRHPLTDEINVYT
KGADSVVMDLLLPCSSDDARGRHQKKIRSKTQNYLNLYAVEGLRTLCIAKRVLSKEEYAC
WLQSHIEAEASVESREELLFQSAVRLETNLHLLGATGIEDRLQEGVPETIAKLRQAGLQI
WVLTGDKQETAINIAYACKLLDHGEEVITLNADSQEACAALLDQCLSYVQSRNPRSTLQN
SESNLSVGFSFNPVSTSTDASPSPSLVIDGRSLAYALEKSLEDKFLFLAKQCRSVLCCRS
TPLQKSMVVKLVRSKLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAVPR
FRYLERLLIVHGHWCYSRLANMVLYFFYKNTMFVGLLFWFQFYCGFSASAMIDQWYLIFF
NLLFSSLPQLVTGVLDKDVPADMLLREPQLYKSGQNMEEYRPRAFWLNMVDAAFQSLVCF
FIPYLAYYDSDVDVFTWGTPVTAIALFTFLLHLGIETKTWTWLNWLACGFSTFLFFSVAL
IYNTSCATCYPPSNPYWTMQTLLGDPLFYLTCLIAPIAALLPRLFFKALQGSLFPTQLQL
GRQLAKKPLNKFSDPKETFAQGQPPGHSETELSERKTMGPFETLPRDCASQASQFTQQLT
CSPEASGEPSAVDTNMPLRENTLLEGLGSQASGSSMPRGAISEVCPGDSKRQSTSASQTA
RLSSLFHLPSFGSLNWISSLSLASGLGSVLQLSGSSLQMDKQDGEFLSNPPQPEQDLHSF
QGQVTGYL
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggagcgggagctcccggcggccgaagagtccgcatcctcgggatggcggcggccgcga
agaaggcgctgggagggcaggacgcgcacggtgcgctccaacctgctaccgcctctgggc
accgaggactccacgatcggagcccccaagggcgagcggctgctgatgcgcggctgcatc
cagcacctggccgacaaccgcctcaagaccaccaagtacacgctgctgtccttcttgccc
aagaatctcttcgagcagttccaccgcctagccaatgtgtacttcgtcttcatcgcgctg
ctcaactttgtgccggctgtgaacgccttccagccgggcctggcactggcgcctgtgctc
ttcattctggcggtcacagccatcaaagacctgtgggaggactacagccgacaccgctcg
gaccatgaaatcaaccacctgggctgccttgtcttcagcagggaagaaaagaagtatgtg
aatcgatactggaaagaaatccgagtgggcgactttgtccgtctttgctgcaatgaaatc
atacctgcggacattttgctgctgtcatccagtgaccctgacgggttgtgccacatcgag
actgctaacctggatggagagaccaacctgaagcggcgccaagtggtccgtggcttctcg
gagcttgtttctgaattcaaccctctgacgttcaccagtgtaatcgagtgtgagaagcca
aacaatgacctgagtaggtttcgtggctacatcatgcacagcaatggggagaaggctggg
ctgcataaggaaaacttgctgcttcgtgggtgcaccatcagaaacacagaggctgtggct
ggaattgtcatctacgcaggacatgaaaccaaagccctgctgaacaatagtgggccccgc
tacaagcgcagccagcttgaaaggcagatgaactgcgatgtcctctggtgtgtccttctc
ctcgtttgtatatctctattttcagcggttgggcatggattgtgggttcggcgctatcaa
gagaaaaaagcactatttgatgttcccgagtctgatggcagctctttatccccagccaca
gctgcagtttactcattttttacaatgataatagttctgcaggttttgattccaatttcc
ttatatgtttccattgaaattgttaaagtgtgccaagtatacttcattaaccaagatata
gagctctatgatgaagagacagattcacagctgcagtgccgagctctgaacataacagaa
gacttagggcagataaaatacatcttctcggacaaaaccggcacattaactgagaacaag
atggtctttcgaagatgcactgtgtccggcatagaatattctcacgatgccaatgctcag
cgactggccaggtatcaagaggcagactcagaagaggaggaagtggtgtccaaggtgggc
acaatatcccaccgtggcagcactgggagccatcagagcatctggatgactcataagacc
caaagtatcaagtcccaccggcgcacaggcagtcgagctgaggcaaagagagccagcatg
ctgtctaagcacactgccttcagcagccccatggagaaagacattacacctgaccccaag
ctgttggagaaggtgagtgagtgtgaccgattcctcgccattgcaaggcaccaggaacac
cctctggcccatctctcacccgagctgtctgatgtttttgatttcttcatcgcactcacc
atctgcaatacagtagttgtcacctctccagaccaaccacgacaaaaggtgagggtgagg
tttgagctgaagtccccagtaaagaccatagaagatttccttcggaggttcacgcccagc
cgcctggcttctggctgcagcagtatcgggaacctgagcaccagtaaatccagccacaaa
tctggatcagcttttctgcccagcctgtctcaggacagcatgcttcttgggctggaggag
aagctgggtcaaacagcaccgtccattgccagcaatggctatgccagccaggcaggccag
gaggaaagctgggcctcagagtgtactacagaccagaagtgtccaggggagcagagggag
cagcaggagggggagctgcgatatgaggctgagagcccagatgaggctgcactggtgtat
gcagccagagcctataactgtgccctggtggaccggcttcacgaccaggtgtctgtggag
ttgccacacctaggcaggctcaccttcgagctgctgcacacacttggcttcgactccatc
cgcaagaggatgtcagtggtgatccgccacccgctgactgacgagatcaatgtatacacc
aagggggccgattcggtggtcatggatcttctgctgccctgttcctcagatgacgccaga
ggaaggcaccagaaaaagatccggagtaaaacacagaattacctcaatctttatgcagta
gaaggcctgcgcaccctgtgcattgccaagagggttctgagcaaagaagagtatgcctgc
tggttgcagagccacatagaagccgaggcgtctgtggagagccgtgaggagctcctcttc
cagtctgccgttcgcctggagacgaacttgcacctgctgggtgccacggggatagaagac
cgccttcaggaaggagtacctgaaaccattgccaaattacgacaagctggcctgcagatt
tgggttctcacaggtgacaaacaggaaacagccattaacattgcatatgcctgcaaactg
ctggatcatggtgaagaggtcatcacactgaatgctgactctcaggaagcatgtgcagcc
ctgctggaccagtgcctcagttatgtgcaatccagaaaccctagaagtacccttcagaac
tctgaaagcaacttgagtgtggggttctctttcaacccagtctccacatccactgacgcc
agccccagcccaagccttgtgattgatggaagaagtctggcctatgccctcgagaaaagc
ctggaggacaaatttcttttccttgccaagcagtgtcgctcagtcctctgctgccgatcg
acccctttgcaaaagagcatggtggtgaagcttgtcagaagcaagctcaaggccatgacc
ttggccataggtgatggggccaatgatgtcagcatgatccaggtggcagatgtaggtgtt
gggatctcaggccaggagggcatgcaggctgtgatggcaagtgactttgcagtgccaaga
ttccgatacctggagagacttttgatcgtccatggacactggtgctactccagactggcc
aatatggtgctgtatttcttctataaaaacacaatgtttgtgggtctcttgttttggttc
cagttttactgtggcttttctgcatctgccatgattgatcagtggtatctgattttcttt
aatctgctcttctcatcacttccccagctggtgactggggtgctggataaagatgttcca
gctgacatgctgctgagagagccacagctttacaagagtggccaaaacatggaggaatac
agaccacgagcattctggttaaacatggtggatgctgcctttcaaagcctggtatgcttt
ttcattccctacctggcctactatgactccgatgtggatgtctttacctgggggacccct
gtcacagcaatagcactgttcaccttcctgctgcacctgggtattgaaaccaaaacctgg
acctggctcaactggttagcctgtggcttcagtacctttttgtttttctccgtggctctg
atttacaacacttcctgtgccacatgctaccctccatctaacccttactggaccatgcag
acattactgggtgaccctctgttctacttgacttgtctcatcgcacctattgctgcattg
ttgcccagattgtttttcaaagccctccaggggagtcttttccccacccaactccagcta
ggacgccagttggccaagaaacccctcaacaaattcagtgatcccaaagagacttttgct
cagggacagccacctggacactcagaaaccgagctttcagaaaggaagaccatgggacct
tttgagactctccctagagactgtgcctctcaagcttcccagttcacacagcagctgacc
tgttccccagaagccagcggggaacccagtgcagtggatacaaacatgccattaagagag
aacaccttgctggaaggacttggctctcaggcctcagggtcctccatgcccagaggggct
atttcagaagtatgtcctggggattctaagagacaatccaccagtgctagtcagactgcc
cgtttgtcgtcactcttccatctgcccagctttggctccctaaattggatctcctcgctg
tcactggccagtgggctgggaagtgtcttgcaattgtctggaagtagtttacagatggat
aagcaggatggtgagtttctatccaacccaccacagccagagcaggacctgcacagcttc
cagggacaagtcacgggctacttatag

DBGET integrated database retrieval system