KEGG   Mus musculus (house mouse): 11987
Entry
11987             CDS       T01002                                 
Symbol
Slc7a1, 4831426K01Rik, Atrc-1, Atrc1, CAT-1, Cat1, ERR, EcoR, Rec-1, Rev-1, mCAT-1
Name
(RefSeq) solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
  KO
K13863  solute carrier family 7 (cationic amino acid transporter), member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    11987 (Slc7a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11987 (Slc7a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   11987 (Slc7a1)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C DUF3278 Chs7
Other DBs
NCBI-GeneID: 11987
NCBI-ProteinID: NP_001288353
MGI: 88117
Ensembl: ENSMUSG00000041313
Position
5:complement(148264220..148336714)
AA seq 622 aa
MGCKNLLGLGQQMLRRKVVDCSREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARE
NAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILS
YIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLT
LGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGF
MPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAA
LTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAE
DGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACV
LVLRYQPEQPNLVYQMARTTEELDRVDQNELVSASESQTGFLPVAEKFSLKSILSPKNVE
PSKFSGLIVNISAGLLAALIITVCIVAVLGREALAEGTLWAVFVMTGSVLLCMLVTGIIW
RQPESKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFTIYFGYGIWH
SEEASLAAGQAKTPDSNLDQCK
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgggctgcaaaaacctgctcggtctgggccagcagatgctgcgccggaaggtggtggac
tgcagccgggaggagagccggctgtcccgctgcctcaacacctatgacctggtagctctt
ggggtgggcagcaccttgggcgctggtgtctatgtcctagccggtgccgtggcccgtgaa
aatgctggccctgccatcgtcatctccttcttgattgctgctctcgcctccgtgctggcc
ggcctgtgctacggcgagtttggtgcccgtgtccccaagacgggctcagcctacctctac
agctacgtgacggtgggggagctttgggccttcatcactggctggaacctgattctctcc
tacatcatcggtacttcaagcgtggcaagagcctggagtgcgacttttgacgagctgata
ggcaagcccatcggagagttctcacgtcagcacatggccctgaatgctcctggggtgctg
gcccaaaccccggacatatttgctgtgattataattatcatcttaacaggactgttaact
cttggcgtgaaggagtcagccatggtcaacaaaattttcacctgtatcaatgtcctggtc
ttgtgcttcatcgtggtgtccgggttcgtgaaaggctccattaaaaactggcagctcacg
gagaaaaatttctcctgtaacaacaacgacacaaacgtgaaatacggtgagggagggttt
atgccctttggattctctggtgtcctgtcaggggcagcgacctgcttttatgccttcgtg
ggctttgactgcatcgccaccacaggggaagaagtcaagaacccccagaaggccattcct
gtgggcatcgtggcgtccctcctcatttgcttcatagcgtactttggcgtgtccgccgct
ctcacgctcatgatgccttacttctgcctggacatcgacagcccgctgcctggtgccttc
aagcaccagggctgggaagaagctaagtacgcagtggccattggctctctctgcgcactt
tccaccagtctcctaggctccatgtttcccatgccccgagttatctatgccatggctgaa
gatggactactgtttaaatttttggccaaaatcaacaataggaccaaaacacccgtaatc
gccactgtgacctcaggcgccattgctgctgtgatggccttcctctttgaactgaaggac
ctggtggacctcatgtccattggcactctcctggcttactctttggtggctgcctgtgtt
ttggtcttacggtaccagccagaacaacctaatctggtataccagatggccagaaccacc
gaggagctagatcgagtagatcagaatgagctggtcagtgccagtgaatcacagacaggc
tttttaccggtagccgagaagttttctctgaaatccatcctctcacccaagaacgtggag
ccctccaaattctcagggctaattgtgaacatttcagccggcctcctagccgctcttatc
atcaccgtgtgcattgtggccgtgcttggaagagaggccctggccgaagggacactgtgg
gcagtctttgtaatgacagggtcagtcctcctctgcatgctggtgacaggcatcatctgg
agacagcctgagagcaagaccaagctctcatttaaggtaccctttgtccccgtacttcct
gtcttgagcatcttcgtgaacatctatctcatgatgcagctggaccagggcacgtgggtc
cggtttgcagtgtggatgctgataggtttcaccatctatttcggttatgggatctggcac
agtgaggaagcgtccctggctgctggccaggcaaagactcctgacagcaacttggaccag
tgcaaatga

DBGET integrated database retrieval system