KEGG   Mus musculus (house mouse): 11989
Entry
11989             CDS       T01002                                 
Symbol
Slc7a3, Atrc3, CAT-3, CAT3, SLC7A1, SLC7A2
Name
(RefSeq) solute carrier family 7 (cationic amino acid transporter, y+ system), member 3
  KO
K13865  solute carrier family 7 (cationic amino acid transporter), member 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11989 (Slc7a3)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   11989 (Slc7a3)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 11989
NCBI-ProteinID: NP_001288769
MGI: 1100521
Ensembl: ENSMUSG00000031297
UniProt: P70423
Position
X:complement(100122752..100134058)
AA seq 618 aa
MLWQALRRFGQKLVRRRVLELGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKD
KAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILS
YVIGTASVARAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLLV
LGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSM
GSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYF
GVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVM
YSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSL
VSICVLILRYQPDQEMKSVEEEMELQEETLEAEKLTVQALFCPVNSIPTLLSGRVVYVCS
SLLAVLLTVLCLVLTWWTTPLRSGDPVWVTVVVLILGLILAISGVIWRQPQNRTPLHFKV
PAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQTLPK
TRAQTIDLDLTTSCVHSI
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgctgtggcaggcacttcgaagatttggtcaaaagctggtgcggagacgtgtgttggag
ctgggtatgggtgagacccgccttgccagatgcctgagcaccctcgacttagtggctctg
ggtgtgggcagcacattaggtgcaggtgtgtatgtcctggctggagaggtggccaaagat
aaagcaggaccatccattgtgatctgctttttggtggctgctctgtcctctgtgttggct
ggactgtgttatgctgaatttggtgcccgggtccccggctctggttctgcatatctctac
agttatgtcaccgtaggtgaactctgggccttcaccaccggctggaatctcattctctcc
tacgtcattggtacagccagtgtggcccgggcttggagctctgcttttgacaacctgatt
ggaaaccacatctctcggactctgaaggggaccatcttgctgaagatgcctcatgttctt
gcagaatatccagatttctttgccttggcccttgtgttgctgctcactggattgctggtt
ttaggggcaagtaaatcagccctggttaccaaagtgttcacagggatgaaccttttggtt
ctcagctttgtcatcatctctggcttcattaagggagaactgagaaactggaagctcacg
aaagaggactattgcttgaccatgagtgaatccaacggcacttgtagcttggactctatg
ggctctggaggtttcatgccttttggcttggaagggattctccgtggcgctgctacctgt
ttctatgccttcgttggttttgactgtattgcaaccaccggagaagaggctcagaatccc
cagcgctccatccccatgggtattgtgatctcgatgttcatctgctttttggcttacttt
ggtgtgtcttcagcacttaccctcatgatgccttactacaagcttcatcctgagagccct
ctgcctgaagcattttcctatgttggctgggagcctgcccgctacttggtggctattggc
tccctctgtgcactttctactagccttttgggctctatgtttcctatgcctcgggtgatg
tattcaatggcagaagatggcctcctgttccgtgtccttgctaaggttcacagtgtcaca
catatacccattgtggccaccttggtatctggtgttattgcagcattcatggcattcctc
tttgaactcactgacctcgtggacctcatgtcaatcgggactctgcttgctcactccctg
gtgtccatttgtgttctcatcctcagatatcagcctgatcaggaaatgaagagtgttgaa
gaggaaatggaattgcaagaggagacacttgaagcagagaagctgactgtccaggctcta
ttttgtcctgtcaactccatccccacactcctttctggccgagttgtctatgtttgctcc
tcactgcttgccgtactactaactgttctttgcctggtgctgacctggtggacaactcca
cttcgttctggagacccagtgtgggtcacagtggttgtgctgatcctggggctcattctt
gcaatttctggggtcatctggagacagccacagaaccgcactccccttcactttaaggtg
cctgctgttcctctactcccactggtgagcatctttgtgaatgtttacctgatgatgcaa
atgacagctggcacttgggcccgatttgggatctggatgctgattggatttgctatctac
tttggctatgggatccaacacagtatgaaagaagttaagaatcatcaaactctacccaaa
acaagggcccaaactatagaccttgatctcacaacttcctgtgttcacagcatttga

DBGET integrated database retrieval system