KEGG   Mus musculus (mouse): 11991Help
Entry
11991             CDS       T01002                                 

Gene name
Hnrnpd, Auf1, Hnrpd
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein D
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    11991 (Hnrnpd)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    11991 (Hnrnpd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 CBFNT RRM_3 NID Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 11991
NCBI-ProteinID: NP_001070733
MGI: 101947
Ensembl: ENSMUSG00000000568
Vega: OTTMUSG00000036763
UniProt: Q60668
Position
5; 5 E4
AA seq 355 aa AA seqDB search
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGS
AEAEGAKIDASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKF
GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagcagttcggaggggacggggcggcggcggcggcaacggcggcggtaggc
ggctcggcgggcgagcaggagggagccatggtggcggcggcggcgcaggggccggcggcg
gcggcgggaagcgggagcggcggcggcggctctgcggccggaggcaccgaaggaggcagc
gccgaggcagagggagccaagatcgacgccagtaagaacgaggaggatgaaggccattca
aactcctccccacgacacactgaagcagcggcggcacagcgggaagaatggaaaatgttt
ataggaggccttagctgggacaccacaaagaaagatctgaaggactacttttccaaattt
ggtgaagttgtagactgcactctgaagttagatcctatcacagggcgatcaaggggtttt
ggctttgtgctatttaaagagtcggagagtgtagataaggtcatggatcagaaagaacat
aaattgaatgggaaagtcattgatcctaaaagggccaaagccatgaaaacaaaagagcct
gtcaaaaaaatttttgttggtggcctttctccagacacacctgaagaaaaaataagagag
tactttggtggttttggtgaggttgaatccatagagctccctatggacaacaagaccaat
aagaggcgtgggttctgttttattacctttaaggaagaggagccagtgaagaagataatg
gaaaagaaataccacaatgttggtcttagtaaatgtgaaataaaagtagccatgtcaaag
gaacagtatcagcagcagcagcagtggggatctagaggagggtttgcaggcagagctcgc
ggaagaggtggaggccccagtcaaaactggaaccagggatatagtaactattggaatcaa
ggctatggcaactatggatataacagccaaggttacggaggttatggaggatatgactac
actggttacaacaactactatggatatggtgattatagcaatcagcagagtggttatggg
aaagtatccaggcgaggtggacatcaaaatagctacaaaccatactaa

DBGET integrated database retrieval system