KEGG   Mus musculus (mouse): 11997Help
Entry
11997             CDS       T01002                                 

Gene name
Akr1b7, AR, Avdp, MVDP
Definition
(RefSeq) aldo-keto reductase family 1, member B7
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu00561  Glycerolipid metabolism
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    11997 (Akr1b7)
   00051 Fructose and mannose metabolism
    11997 (Akr1b7)
   00052 Galactose metabolism
    11997 (Akr1b7)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    11997 (Akr1b7)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    11997 (Akr1b7)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldose reductase
     11997 (Akr1b7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red HU-CCDC81_euk_1
Motif
Other DBs
NCBI-GeneID: 11997
NCBI-ProteinID: NP_033861
MGI: 101918
Ensembl: ENSMUSG00000052131
Vega: OTTMUSG00000014785
UniProt: P21300 Q5M9J9
Position
6 B1; 6 14.95 cM
AA seq 316 aa AA seqDB search
MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQ
EKIKENAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQAGN
ALLPKDNKGKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKP
VTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAK
HKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACD
LLDARTEEDYPFHEEY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttcgtggaactcagtaccaaagccaagatgccccttgtgggcctgggcacc
tggaagtcttccccaggccaagtcaaggaagccgtgaaggcggccattgatgctgggtat
cgccacattgactgtgcctatgtgtatcacaatgagaatgaggtgggagaagctatccaa
gagaagatcaaagagaatgctgtgaagcgggaggatctcttcatcgtcagcaagctgtgg
gccacattctttgagaaaagcctggtgaagaaagccttccagaacaccctctcggatctg
aagctggactatctggacctgtatctggtccactggccacagggatttcaggctgggaat
gcgttattacccaaagacaataaaggcaaagttctcctgagtaaatccacattcttggat
gcctgggaggccatggaggaactggtggaccaggggctggtgaaagctctgggcatctcc
aacttcaaccacttccagattgaaaggctcctgaacaagcctggactaaaacataagcca
gtgaccaaccagattgagagccacccttatctcacccaggaaaaactgatccaatactgt
caatccaagggcatcgctgttacagcctacagtcccctgggctccccagacaggccttat
gccaagccagaagaccccgtagtaatggagattcccaagatcaaagagattgctgcaaaa
cacaagaaaacagtagctcaggttctgattcggttccatgtccaaaggaatgtggtggtg
atccccaagtctgtgacaccctcacgcatacaggagaacctgcaggtcttcgacttccag
ttgagtgaggaggacatggctgccattctcagcttcaacaggaactggagggcctgtgac
ctgttggatgcaaggactgaagaggactatcctttccacgaggaatactga

DBGET integrated database retrieval system