KEGG   Mus musculus (mouse): 11998Help
Entry
11998             CDS       T01002                                 

Gene name
Avp, Vp, Vsp
Definition
(RefSeq) arginine vasopressin
  KO
K05242  arginine vasopressin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04270  Vascular smooth muscle contraction
mmu04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    11998 (Avp)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11998 (Avp)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    11998 (Avp)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    11998 (Avp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 11998
NCBI-ProteinID: NP_033862
MGI: 88121
Ensembl: ENSMUSG00000037727
Vega: OTTMUSG00000015526
UniProt: P35455 Q3UUQ5
Position
2 F1; 2 63.24 cM
AA seq 168 aa AA seqDB search
MLARMLNTTLSACFLSLLAFSSACYFQNCPRGGKRAISDMELRQCLPCGPGGKGRCFGPS
ICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAVGICCSDESCVAEPEC
HDGFFRLTRAREPSNATQLDGPARALLLRLVQLAGTRESVDSAKPRVY
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaggatgctcaacactacgctctccgcttgtttcctgagcctgctggccttc
tcctccgcctgctacttccagaactgcccaagaggcggcaagagggccatctctgacatg
gagctgagacagtgtctcccctgcggcccgggcggcaaaggacgctgcttcggaccaagc
atctgctgcgcggacgagctgggctgcttcgtgggcaccgccgaggcgctgcgctgccag
gaggagaactacctgccctcgccctgccagtccggccagaagccctgcgggagcgggggc
cgctgcgccgccgtgggcatctgctgcagcgacgagagctgcgtggccgagcccgagtgc
cacgacggttttttccgcctcacccgcgctcgggagccaagcaacgccacacagctggac
ggccctgctcgggcgctgctgctaaggctggtacagctggctgggacacgggagtccgtg
gattctgccaagccccgggtctactga

DBGET integrated database retrieval system