KEGG   Mus musculus (mouse): 12006Help
Entry
12006             CDS       T01002                                 

Gene name
Axin2, Axi1, Axil, Conductin
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04934  Cushing's syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12006 (Axin2)
   04390 Hippo signaling pathway
    12006 (Axin2)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12006 (Axin2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12006 (Axin2)
   05210 Colorectal cancer
    12006 (Axin2)
   05225 Hepatocellular carcinoma
    12006 (Axin2)
   05226 Gastric cancer
    12006 (Axin2)
   05217 Basal cell carcinoma
    12006 (Axin2)
   05213 Endometrial cancer
    12006 (Axin2)
   05224 Breast cancer
    12006 (Axin2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    12006 (Axin2)
  Infectious diseases
   05165 Human papillomavirus infection
    12006 (Axin2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12006 (Axin2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind SdrD_B
Motif
Other DBs
NCBI-GeneID: 12006
NCBI-ProteinID: NP_056547
MGI: 1270862
Ensembl: ENSMUSG00000000142
Vega: OTTMUSG00000003199
UniProt: O88566 Q3UQK5
Position
11 E1; 11 71.83 cM
AA seq 840 aa AA seqDB search
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGVPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQQCH
TLLPTGGKLPPVAACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCL
CPGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTLPKRNAKGTEPGLALSARDGGMSSA
AGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESACAAPGERVSRHHL
LGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRD
RNHSAAGQAGASPFANPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKA
QSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgccgtgttagtgactctccttccagatcccagcagcagcttccgcgaggat
gctccgcggcccccggttccgggagaagaaggggagaccccaccgtgtcagcctagtgtg
ggcaaggtccagtccaccaaacctatgcccgtttcctctaatgctaggcggaatgaagat
ggactgggggagcccgaggggcgggcctcccccgattcccctttgaccaggtggaccaag
tctttacactccttgttgggtgaccaggatggtgcatacctcttccggactttcctggag
agggagaaatgtgtggatacgctggacttctggtttgcttgtaatgggttcaggcagatg
aacctgaaggataccaaaactttgcgagtggccaaagcaatctataagaggtacattgag
aacaacagcgttgtctccaagcagctgaagcccgccaccaagacctacatacgagatggc
atcaagaagcaacagatcggctcggtcatgtttgaccaggcacagaccgagatccaggca
gtgatggaggaaaatgcctaccaggtgttcttgacttctgacatttacctggaatatgtg
aggagtgggggggaaaacacagcttacatgagtaacgggggactggggagcctaaaggtc
ttatgtggctacctccccaccttgaatgaagaagaggagtggacgtgtgccgacctcaag
tgcaaactctcacccaccgtggttggcttgtccagcaaaactcttcgggccaccgcgagt
gtgagatccacggaaacagctgaaaacggattcaggtccttcaagagaagcgacccagtc
aatccttatcacgtaggttccggctatgtctttgcaccagccaccagcgccaacgacagc
gagttatccagcgacgcactgaccgacgattccatgtccatgacggacagtagcgtagat
ggagtccctccttaccgcatggggagtaagaaacagctccagagagagatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacgcctgtggaacctgctgccttcgccgccgagctcatctccaggctggagaaa
ctgaaactggagctggaaagccgccatagtctggaggagcggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggtccag
caccccctggccctcctaccctccggcagctatgaagaggacccacaaaccattttggac
gaccacctctccagggtcctcaagacccccggctgtcaatcccctggtgtgggtcgctat
agcccacggtcccgctcccccgaccaccaccaccagcaccaccaccatcagcagtgtcat
acccttcttccgactgggggcaagctgccccccgtggctgcttgccccctccttggaggc
aagagcttcctgaccaaacagacgacgaagcacgttcaccaccactacatccaccaccac
gctgtccccaagaccaaggaggagatcgaggcagaagccacacagagagtccgctgcctc
tgtcctgggggaacagattattattgctactccaaatgcaaaagccacccaaaggctcca
gagcccctgcctggggagcagttttgtggcagcagaggtggtaccttgccaaaacggaat
gcaaagggcaccgaaccgggtcttgcactgtcggccagggatggagggatgtccagtgca
gcgggggccccccagcttcctggggaagaaggagaccggtcacaggatgtctggcagtgg
atgttagagagtgagcggcagagcaagtccaagccccatagtgcccaaagcataagaaag
agctacccattggagtctgcctgtgcggccccaggagaacgagtcagccggcaccatctg
ttgggggccagcggacactcccgctcggtggcccgggctcacccatttacccaggaccct
gcaatgcctccccttaccccacccaacactttggcacagctagaggaagcctgccgcagg
ctggcagaggtgtcgaagccccagaagcagcggtgctgcgtggccagtcagcagagggac
aggaaccactcggctgctggtcaggcaggagcctcacccttcgccaacccaagcctggct
ccagaagatcacaaagagccaaagaaactggcaagtgtccacgcgctccaggccagtgag
ctggttgtcacctactttttctgtggagaagaaattccatacaggaggatgctgaaggct
caaagcttgaccctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtat
tatttcaagaaggcgagtgacgaatttgcctgcggagcagtttttgaggagatctgggac
gacgagacagtgctccccatgtacgaaggcaggatcctgggcaaagtggagaggatcgac
tga

DBGET integrated database retrieval system