KEGG   Mus musculus (mouse): 12007Help
Entry
12007             CDS       T01002                                 

Gene name
Azgp1, Zag
Definition
(RefSeq) alpha-2-glycoprotein 1, zinc
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I MHC_I_3 C1-set MHC_II_beta
Motif
Other DBs
NCBI-GeneID: 12007
NCBI-ProteinID: NP_038506
MGI: 103163
Ensembl: ENSMUSG00000037053
Vega: OTTMUSG00000054656
UniProt: Q64726
Position
5 G2; 5 76.92 cM
AA seq 307 aa AA seqDB search
MVPVLLSLPLLLGPAVFQETGSYYLTFLYTGLSRPSKGFPRFQATAFLNDQAFFHYNSNS
GKAEPVGPWSQVEGMEDWEKESQLQRAREEIFLVTLKDIMDYYKDTTGSHTFQGMFGCEI
TNNRSSGAVWRYAYDGEDFIEFNKEIPAWIPLDPAAANTKLKWEAEKVYVQRAKAYLEEE
CPEMLKRYLNYSRSHLDRIDPPTVTITSRVIPGGNRIFKCLAYGFYPQRISLHWNKANKK
LAFEPERGVFPNGNGTYLSWAEVEVSPQDIDPFFCLIDHRGFSQSLSVQWDRTRKVKDEN
NVVAQPQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgtcctgctgtccctgcctctccttctgggtcctgcagtctttcaggagact
gggtcttattatctgacctttctctacaccgggttgtccagacccagcaaaggttttccg
aggtttcaagccactgcatttctcaatgaccaggccttcttccactacaacagcaacagc
gggaaggcagagcctgtgggaccttggagccaggtggaaggaatggaggactgggagaag
gaaagccagcttcagagggccagggaggagatcttccttgtgaccctgaaagacatcatg
gactattacaaggacactacagggtctcacacctttcagggaatgtttggttgcgagatc
acaaataacagaagtagtggagctgtctggaggtatgcctacgacggagaggatttcatc
gaattcaacaaagaaatcccagcttggatccccttagacccagcagctgcaaacaccaag
ctaaagtgggaagcagaaaaggtctacgtgcagcgagccaaggcatacctagaggaggag
tgtcctgaaatgctgaagaggtacctgaactacagtcgatctcacctggaccgaatagat
cctcccactgtgacaatcaccagccgtgtgatcccaggaggaaacagaatattcaaatgc
ctggcctatggcttctacccacaaagaattagtctgcactggaacaaggccaacaagaag
ctagcatttgaaccagaaagaggtgtttttcccaatggaaatggcacttacctctcctgg
gcagaggtggaagtctccccacaggacatagaccccttcttctgcctcatagatcacagg
gggttttcccaatctctctcggtgcagtgggataggacaagaaaagtaaaggatgaaaac
aatgttgtagctcagcctcagtaa

DBGET integrated database retrieval system