KEGG   Mus musculus (mouse): 12010
Entry
12010             CDS       T01002                                 

Gene name
B2m, Ly-m1, Ly-m11, beta2-, beta2-m, beta2m
Definition
(RefSeq) beta-2 microglobulin
  KO
K08055  beta-2-microglobulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04612  Antigen processing and presentation
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12010 (B2m)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12010 (B2m)
   05170 Human immunodeficiency virus 1 infection
    12010 (B2m)
   05168 Herpes simplex virus 1 infection
    12010 (B2m)
   05163 Human cytomegalovirus infection
    12010 (B2m)
   05169 Epstein-Barr virus infection
    12010 (B2m)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12010 (B2m)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   12010 (B2m)
SSDB
Motif
Pfam: C1-set Ig_3 Ig_2
Other DBs
NCBI-GeneID: 12010
NCBI-ProteinID: NP_033865
MGI: 88127
Ensembl: ENSMUSG00000060802
Vega: OTTMUSG00000015534
UniProt: P01887
Structure
PDB: 
1LK2 1KPU 1G7P 5WEU 3GMO 3G08 1G7Q 6C6F 3T1F 3GML 3GMN 3GMP 3ECB 1FZK 1KPV 5TW2 5M02 1LEG 6GB6 6C6J 5EFI 5FKP 3GMM 3GMQ 2ZSV 2FIK 1T0N 1FZM 1FZO 5TW5 3ILP 6G9Q 4L8D 3VJ6 3PWU 3GMR 2CLV 2AKR 1U58 1RJY 1FZJ 3CC5 6I8C 6MJJ 6C69 6CYW 5M00 5M01 2Q7Y 5T7G 5E8O 3WS6 1S7Q 1S7S 6MJ4 6CW9 6C6H 5E8P 4PGE 4PV9 4HV8 4HUU 3ROO 3QUL 3P9L 3P9M 1T0M 1JUF 3FON 6MIV 6CXE 5VCL 3ILQ 6C6C 5WLG 5IVX 4HS3 3TBV 3FOM 3E6H 2ZOK 1RK1 1PQZ 1OSZ 1MHC 6A97 6GB7 3TBW 1LEK 6OJP 6C6E 1JPF 6CWE 5WLI 4ZUU 4L8B 4HUX 3RUG 3PAB 1Z5L 1YN7 1YN6 1S7U 1S7V 1JPG 1INQ 1KBG 4MX7 5E8N 3QUY 3MA7 6MJI 6GB5 6BMH 5J6H 4ZUV 4PGC 3TBT 3QUZ 3QI9 3P4O 3CH1 1S7T 1NAN 1KJ3 1K8D 2VAA 4PV8 3WS3 6MJA 5KD7 6CX9 6H6D 6H6H 6CX5 5MZM 5JWE 4PG9 1S7W 1MWA 1BII 1LD9 1HOC 3QUK 3E6F 1S7X 6BMK 6OOR 6MJ6 6C6A 6C5M 3TBS 6CXF 5JWD 4HUV 3TBY 3SCM 3AU1 3P4M 3P4N 3FOL 3CPL 1ZT1 1FO0 1VAC 1VAD 2VAB 2MHA 6CX7 6BNL 4ZUS 4ZUT 4ZUW 4Y16 4NSK 4MQ7 3ROL 3FTG 3DMM 3CCH 3BUY 2FWO 1RJZ 1FFP 2GAZ 1RK0 5WET 6CXA 5SWZ 2VE6 1FFO 1CD1 6G9R 4PGD 3TA3 3ARB 3NWM 3L3H 2ZOL 2FO4 1ZHB 1NAM 1FFN 5WES 1KJ2 3O8X 6MIY 1FG2 4PG2 4PGB 4L8C 4IRS 4IHO 3TVM 3SDA 3RZC 3RTQ 3ARE 3O9W 3HE7 2ZSW 1ZHN 1G6R 1BZ9 1BQH 4ZAK 5TIL 6CWB 6CW6 1N5A 5SWS 4Y4K 3RGV 3ARF 3HE6 3CVH 3C8K 2OL3 1P4L 3QUX 1S7R 1N59 6MSS 6MJQ 4IRJ 4APQ 3SDD 3ARG 1ZT7 1N3N 2CKB 4MNG 3ARD 5KD4 4Y2D 4Y4H 4EI5 3UBX 3TO4 3SDC 1DDH 1LDP 5VCJ 4HUW 4Y4F 3PQY 6BNK 5TJE 3TN0 1P1Z 5J6G 4ELM 2CLZ 1WBX 1WBY 1WBZ 1QO3

Position
2 E5; 2 60.55 cM
AA seq 119 aa
MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQML
KNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
NT seq 360 nt   +upstreamnt  +downstreamnt
atggctcgctcggtgaccctggtctttctggtgcttgtctcactgaccggcctgtatgct
atccagaaaacccctcaaattcaagtatactcacgccacccaccggagaatgggaagccg
aacatactgaactgctacgtaacacagttccacccgcctcacattgaaatccaaatgctg
aagaacgggaaaaaaattcctaaagtagagatgtcagatatgtccttcagcaaggactgg
tctttctatatcctggctcacactgaattcacccccactgagactgatacatacgcctgc
agagttaagcatgccagtatggccgagcccaagaccgtctactgggatcgagacatgtga

DBGET integrated database retrieval system