KEGG   Mus musculus (mouse): 12012
Entry
12012             CDS       T01002                                 

Gene name
Baat, AI118337, AI158864, BA, BAT
Definition
(RefSeq) bile acid-Coenzyme A: amino acid N-acyltransferase
  KO
K00659  bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu00430  Taurine and hypotaurine metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu04976  Bile secretion
Module
mmu_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    12012 (Baat)
   01040 Biosynthesis of unsaturated fatty acids
    12012 (Baat)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    12012 (Baat)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    12012 (Baat)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    12012 (Baat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.65  bile acid-CoA:amino acid N-acyltransferase
     12012 (Baat)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     12012 (Baat)
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH Peptidase_S9
Other DBs
NCBI-GeneID: 12012
NCBI-ProteinID: NP_031545
MGI: 106642
Ensembl: ENSMUSG00000039653
Vega: OTTMUSG00000008315
UniProt: Q91X34
Position
4 B1; 4 26.51 cM
AA seq 420 aa
MAKLTAVPLSALVDEPVHIQVTGLAPFQVVCLQASLKDEKGNLFSSQAFYRASEVGEVDL
EHDPSLGGDYMGVHPMGLFWSLKPEKLLGRLIKRDVMNSPYQIHIKACHPYFPLQDIVVS
PPLDSLTLERWYVAPGVKRIQVKESRIRGALFLPPGEGPFPGVIDLFGGAGGLMEFRASL
LASRGFATLALAYWNYDDLPSRLEKVDLEYFEEGVEFLLRHPKVLGPGVGILSVCIGAEI
GLSMAINLKQIRATVLINGPNFVSQSPHVYHGQVYPPVPSNEEFVVTNALGLVEFYRTFQ
ETADKDSKYCFPIEKAHGHFLFVVGEDDKNLNSKVHANQAIAQLMKNGKKNWTLLSYPGA
GHLIEPPYTPLCQASRMPILIPSLSWGGEVIPHAAAQEHSWKEIQKFLKQHLLPDLSSQL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggccaagctgacagctgttcctctcagtgctcttgttgatgagcctgtgcacatccag
gtcacaggcctggccccctttcaggtggtgtgccttcaggcatcactgaaagatgagaag
ggaaacctgtttagttctcaggccttctacagggccagtgaagtgggtgaggtagatctg
gagcatgacccctcacttggaggagactatatgggggtccaccccatgggccttttctgg
tccttgaaacctgaaaagctattgggtagattgataaaaagagatgtgatgaatagcccc
taccaaatccacataaaagcttgccatccatactttccattacaagacatagtcgtcagt
cctcccttggatagcctgactctggaaaggtggtatgtggcacctggggtcaagaggatc
caggtaaaggaaagccgcatccggggagccctgtttctgcctccaggagaaggtcctttt
ccaggggtcattgacttgtttggaggtgctggtggattgatggagttccgggccagtctt
ctggcaagtcgtggctttgccaccttagctctggcttactggaactatgatgacctgcct
tctcgactggagaaggtagatctagaatattttgaagaaggtgtagagtttctcctgaga
catcctaaggtcctcggcccaggtgttggcatcctttctgtatgcattggagcagagatt
ggactttctatggctattaacctaaaacaaataagagccactgtacttatcaatgggcct
aattttgtttctcaaagtccacatgtatatcatggtcaggtctacccacctgtacccagt
aatgaagagtttgtagtcaccaatgccttgggacttgtagaattctatcgaacctttcag
gaaactgcagataaggacagcaaatattgttttcccattgaaaaagctcatggacatttc
ctttttgtggttggagaagatgataaaaatctcaacagcaaagtgcatgctaatcaagcc
atagcacagctgatgaaaaatggaaagaagaattggactctgctgtcttaccctggggca
ggtcacctgattgagcctccctataccccactgtgccaagcctcaaggatgcccattttg
atcccaagcctcagctggggaggagaggttatcccccatgcagctgcacaggagcattct
tggaaggagatacagaaatttctcaagcagcatctccttccagatttgagcagtcagctc
tga

KEGG   Mus musculus (mouse): 209186
Entry
209186            CDS       T01002                                 

Gene name
Acnat2, C730036D15Rik
Definition
(RefSeq) acyl-coenzyme A amino acid N-acyltransferase 2
  KO
K00659  bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu00430  Taurine and hypotaurine metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu04976  Bile secretion
Module
mmu_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    209186 (Acnat2)
   01040 Biosynthesis of unsaturated fatty acids
    209186 (Acnat2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    209186 (Acnat2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    209186 (Acnat2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    209186 (Acnat2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.65  bile acid-CoA:amino acid N-acyltransferase
     209186 (Acnat2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     209186 (Acnat2)
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH FSH1
Other DBs
NCBI-GeneID: 209186
NCBI-ProteinID: NP_663343
MGI: 2444345
Ensembl: ENSMUSG00000060317
Vega: OTTMUSG00000006911
UniProt: Q8BGG9
Position
4; 4 B1
AA seq 420 aa
MMIQLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVD
LEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPLCICLDLYDSVNWLETVRI
PSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGIIDLFGLIGGLVEFRASL
LASHGFAVLALAYFAYEDLPEKPQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEI
GLAMACYLKQVIATVCINGPTTITIFPLRYQDLVMTPIHPALERIQVHDSGALLFRYTTQ
YLHNKLNSQNILPVEKAQGKILFIVGENDECLDSKLHAQKAMDRLQRHGRSSGRMLAYPG
AGHLIEPPYSPVCFVAWFPVLGQPMCFGGDLMAHAAAQEHSWREIQKFFRKHLLQSGSKL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatgatccagttgatagccacaccttcaaatgcccttgtggatgagcctgtgtccatt
cgagcaacaggcctgcctccatcgcagatagtgaccatcaaggcaacagtgaaagatgaa
aatgacaatgtgttccaatcccaagccttctacaagactaacgaggctggtgaggtggac
ctggagaagacaccggctttggggggtgactatgtaggggtccacccaatgggcctcttt
ttctctctgaaacccaagaaggctttccataggctgatgaagaaagatgtgatgaacagc
cccctttgcatctgtttggacctgtacgactctgttaactggctagaaacagtcaggatt
ccatccaaggccagccagagagtgcagcgctggtttgttggccctggggttaagcgggaa
cagattcaagaaggtcgggttcggggagccctttttctccctccagggaaaggtcctttc
ccaggaattattgatttgtttggtctcattgggggtctagttgaatttcgtgcaagtctt
ttggcatcccacggctttgctgtgctggcattggcatattttgcctatgaagacctgcct
gagaaaccacaagaggtggacttggagtattttgaagaagctgctaacttcctactatct
caccccaagatccaacagccaggaattggtgtgatctccacgagcaaaggagcagagatt
gggctagctatggcctgttacctgaagcaggtgattgccacagtctgcataaatgggccc
accaccatcacaatcttcccactaagataccaggatctggtgatgacaccaatccatccg
gctctggaacggatccaagtccatgattcaggggctttactcttccgttacactacacaa
tatctccataataagctgaactcacagaatatacttcccgtggaaaaggcccaggggaaa
atcctcttcattgtgggagagaatgatgaatgtttggatagcaagttgcatgcacagaag
gccatggaccggctccagaggcatggaagaagcagtggaaggatgctggcataccctggg
gcaggccacctcatagagccaccttattctcccgtttgctttgtggcctggttccctgtc
ctgggtcaacccatgtgttttggaggagatctcatggctcacgcagcagcccaggaacac
tcctggagagagatccaaaagttcttcaggaaacacctccttcaatccggaagcaaactc
taa

KEGG   Mus musculus (mouse): 230161
Entry
230161            CDS       T01002                                 

Gene name
Acnat1, AI132189
Definition
(RefSeq) acyl-coenzyme A amino acid N-acyltransferase 1
  KO
K00659  bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00120  Primary bile acid biosynthesis
mmu00430  Taurine and hypotaurine metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu04976  Bile secretion
Module
mmu_M00106  Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    230161 (Acnat1)
   01040 Biosynthesis of unsaturated fatty acids
    230161 (Acnat1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    230161 (Acnat1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    230161 (Acnat1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    230161 (Acnat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.65  bile acid-CoA:amino acid N-acyltransferase
     230161 (Acnat1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     230161 (Acnat1)
SSDB
Motif
Pfam: BAAT_C Bile_Hydr_Trans DLH FSH1
Other DBs
NCBI-GeneID: 230161
NCBI-ProteinID: NP_001158037
MGI: 2140197
Ensembl: ENSMUSG00000070985
Vega: OTTMUSG00000008317
UniProt: A2AKK5
Position
4; 4 B1
AA seq 416 aa
MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVD
LEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPFCICLDLYDSVNWLETVRI
PSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGIIDLFGVIGGLVEFRASL
LASHGFAVLALAYFAYKDLPEKLQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEI
GLAMACYLKQVIATVCINGATTTTAVPLRYQDLVVTPIQQALERMEVHVSGAVCFRHTTQ
YLQNKNILPVEKAQGKILFIVGENDELLDSKLHAQRAMDRLRRHGRSSGRMLAYPGAGHL
IEPPYSPLCFASWQPVLGRPMCFGGDLMAHAAAQEHSWREIQKFFRKHLLQSGSKL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgatgatcaagttgatagccacaccttcaaatgcccttgtggatgagcctgtgtccatt
cgagcaacaggcctgcctccatcgcagatagtgaccatcaaggcaacagtgaaagatgaa
aatgacaatgtgttccaatcccaagccttctacaagactaacgaggctggtgaggtggac
ctggagaagacaccggccttggggggtgactatgtaggggtccacccaatgggcctcttt
ttctctctgaaacccaagaaggctttccataggctgatgaagaaagatgtgatgaacagc
cccttttgcatctgtttggacctgtacgactctgttaactggctagaaacagtcaggatt
ccatccaaggccagccagagagtgcagcgctggtttgttggccctggggttaagcgggaa
cagattcaagaaggtcgggttcggggagccctttttctccctccagggaaaggtcctttc
ccaggaattattgatttgtttggtgtcattgggggtctagttgaatttcgtgccagtctt
ttggcttcccatggctttgcagtgctggcgttggcgtattttgcctataaagacctgcct
gagaaactgcaagaggtggacttggagtattttgaagaagctgccaacttcctactatct
caccccaagatccaacagccaggaattggtgtgatctccacgagcaaaggagcagagatt
gggctagctatggcctgttacctgaagcaggtgattgccacggtctgcataaatggggcc
accaccaccacagccgtcccactaagataccaggatctggttgtgacacccatccaacag
gctctggaacggatggaggtccatgtttcaggggctgtatgcttccgtcacactacacaa
tatctccagaataagaatatacttcccgtggaaaaggcccaggggaagatcctcttcatt
gtgggagagaatgatgaattgttggatagcaagttacatgcacagagggccatggaccgg
ctccggaggcatggaagaagcagtggaaggatgctggcataccctggggcaggccacctc
atagagccaccttattctcccctttgctttgcatcctggcaacctgtcctgggtcgaccc
atgtgttttggaggagatctcatggctcacgcagcagcccaggaacactcctggagagag
atccaaaagttcttcaggaaacacctccttcaatccggaagcaaactctaa

DBGET integrated database retrieval system