KEGG   Mus musculus (mouse): 12017Help
Entry
12017             CDS       T01002                                 

Gene name
Bag1, BAG-1, Rap46
Definition
(RefSeq) BCL2-associated athanogene 1
  KO
K09555  BCL2-associated athanogene 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12017 (Bag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12017 (Bag1)
   04131 Membrane trafficking [BR:mmu04131]
    12017 (Bag1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  BAG
   12017 (Bag1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    12017 (Bag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin BAG DUF5082
Motif
Other DBs
NCBI-GeneID: 12017
NCBI-ProteinID: NP_033866
MGI: 108047
Ensembl: ENSMUSG00000028416
Vega: OTTMUSG00000006605
UniProt: Q60739 Q9CUY1 A0A1L1SRT0
Structure
PDB: 

Position
4; 4 A5
AA seq 355 aa AA seqDB search
MAGRSAARRPRGDREPLGPRLRAPRPAREPRQSESRAERGLPPSQRSSVRSAASGHDRST
RGAAAGACKPRVKKKVRPRSSQSEKVGSSSRELTRSKKVTRSKNVTGTQVEEVTKIEEAT
QTEEVTVAEEVTQTDNMAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVV
QDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSNPEEEVEL
KKLKDLEVSAEKIANHLQELNKELSGIQQGFLAKELQAEALCKLDRKVKATIEQFMKILE
EIDTMVLPEQFKDSRLKRKNLVKKVQVFLAECDTVEQYICQETERLQSTNLALAE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ctggcgggtcgcagcgccgcgcggcgaccgcgaggcgaccgggagccgctgggacccagg
ctgcgcgcccctcggcctgcccgggagccgcgccagtcggagtcccgggccgagcggggc
ttgcctccctctcagcgttcctctgtgcgcagtgcagccagcgggcatgaccgatccacc
aggggcgccgccgccggcgcctgcaagccgcgggtgaagaagaaagtccggccccgctct
tctcagagcgagaaggtagggagcagcagcagggagttgactagaagtaagaaagtgacc
cgtagcaagaacgtgaccgggacccaggtagaggaggtgaccaagatcgaggaggcgacc
caaaccgaggaagtaactgtggcagaagaggtgacccagaccgacaacatggccaagacc
gaggagatggtccagacggaggaaatggaaacacccagactcagcgtgatcgtcacccac
agcaatgagaggtatgaccttcttgttaccccacagcaaggtaacagtgagccagttgtc
caagacttggctcagcttgttgaagaggccacaggagttccactaccttttcagaagctc
atatttaagggaaaatctctgaaagaaatggaaacaccgttgtcagcacttggaatgcaa
aatggttgccgagtcatgttaattggtgaaaagagcaatccagaagaagaggttgagtta
aagaagctgaaagatttggaggtatctgcagagaagatagctaaccacctgcaagaattg
aataaagagctttctggcatccagcagggttttctggctaaggaattgcaagcggaggct
ctctgcaaacttgataggaaagtaaaagcaacaattgagcaattcatgaagatcttggag
gagattgacacaatggtcctaccagaacaatttaaagacagcaggctaaaaaggaagaat
ttggtgaaaaaggttcaggtgttcttagcagagtgtgacacagtggagcaatacatctgc
caagagacagagcggctgcagtctacaaacttggccctggctgaatga

DBGET integrated database retrieval system