KEGG   Mus musculus (mouse): 12017
Entry
12017             CDS       T01002                                 

Gene name
Bag1, BAG-1, Ra, Rap46
Definition
(RefSeq) BCL2-associated athanogene 1
  KO
K09555  BCL2-associated athanogene 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12017 (Bag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12017 (Bag1)
   04131 Membrane trafficking [BR:mmu04131]
    12017 (Bag1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  BAG
   12017 (Bag1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    12017 (Bag1)
SSDB
Motif
Pfam: ubiquitin BAG DUF2935
Other DBs
NCBI-GeneID: 12017
NCBI-ProteinID: NP_033866
MGI: 108047
Ensembl: ENSMUSG00000028416
Vega: OTTMUSG00000006605
UniProt: Q60739 Q9CUY1
Structure
PDB: 
2M8S 2LWP 1I6Z

Position
4; 4 A5
AA seq 355 aa
MAGRSAARRPRGDREPLGPRLRAPRPAREPRQSESRAERGLPPSQRSSVRSAASGHDRST
RGAAAGACKPRVKKKVRPRSSQSEKVGSSSRELTRSKKVTRSKNVTGTQVEEVTKIEEAT
QTEEVTVAEEVTQTDNMAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVV
QDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSNPEEEVEL
KKLKDLEVSAEKIANHLQELNKELSGIQQGFLAKELQAEALCKLDRKVKATIEQFMKILE
EIDTMVLPEQFKDSRLKRKNLVKKVQVFLAECDTVEQYICQETERLQSTNLALAE
NT seq 1068 nt   +upstreamnt  +downstreamnt
ctggcgggtcgcagcgccgcgcggcgaccgcgaggcgaccgggagccgctgggacccagg
ctgcgcgcccctcggcctgcccgggagccgcgccagtcggagtcccgggccgagcggggc
ttgcctccctctcagcgttcctctgtgcgcagtgcagccagcgggcatgaccgatccacc
aggggcgccgccgccggcgcctgcaagccgcgggtgaagaagaaagtccggccccgctct
tctcagagcgagaaggtagggagcagcagcagggagttgactagaagtaagaaagtgacc
cgtagcaagaacgtgaccgggacccaggtagaggaggtgaccaagatcgaggaggcgacc
caaaccgaggaagtaactgtggcagaagaggtgacccagaccgacaacatggccaagacc
gaggagatggtccagacggaggaaatggaaacacccagactcagcgtgatcgtcacccac
agcaatgagaggtatgaccttcttgttaccccacagcaaggtaacagtgagccagttgtc
caagacttggctcagcttgttgaagaggccacaggagttccactaccttttcagaagctc
atatttaagggaaaatctctgaaagaaatggaaacaccgttgtcagcacttggaatgcaa
aatggttgccgagtcatgttaattggtgaaaagagcaatccagaagaagaggttgagtta
aagaagctgaaagatttggaggtatctgcagagaagatagctaaccacctgcaagaattg
aataaagagctttctggcatccagcagggttttctggctaaggaattgcaagcggaggct
ctctgcaaacttgataggaaagtaaaagcaacaattgagcaattcatgaagatcttggag
gagattgacacaatggtcctaccagaacaatttaaagacagcaggctaaaaaggaagaat
ttggtgaaaaaggttcaggtgttcttagcagagtgtgacacagtggagcaatacatctgc
caagagacagagcggctgcagtctacaaacttggccctggctgaatga

KEGG   Mus musculus (mouse): 15505
Entry
15505             CDS       T01002                                 

Gene name
Hsph1, 105kDa, AI790491, HSP1, Hsp105, Hsp110, hsp-, hsp-E7I, hsp110/1, hsp110/105
Definition
(RefSeq) heat shock 105kDa/110kDa protein 1
  KO
K09485  heat shock protein 110kDa
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15505 (Hsph1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15505 (Hsph1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP110
   15505 (Hsph1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl F-box-like_2 FGGY_C HBM
Other DBs
NCBI-GeneID: 15505
NCBI-ProteinID: NP_038587
MGI: 105053
Ensembl: ENSMUSG00000029657
Vega: OTTMUSG00000021374
UniProt: Q61699
Position
5 G3; 5 89.18 cM
AA seq 858 aa
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSSFKRFHGRAFNDPFIQKEKENLSYDLVPMKNGGVGIKVMYMDEEHFFSVEQITAM
LLTKLKETAENNLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPNAEEKPRVVVFVDMGHSSFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLHQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLHSLMAQTQLKAEDVSAIEIVGGATRIPAVKERIAKFFGK
DVSTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLVWNHDSEETEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEEEDGSSLEADMECPNQRPTESSDVDKNIQQDNSEAG
TQPQVQTDGQQTSQSPPSPELTSEESKTPDADKANEKKVDQPPEAKKPKIKVVNVELPVE
ANLVWQLGRDLLNMYIETEGKMIMQDKLEKERNDAKNAVEECVYEFRDKLCGPYEKFICE
QEHEKFLRLLTETEDWLYEEGEDQAKQAYIDKLEELMKMGTPVKVRFQEAEERPKVLEEL
GQRLQHYAKIAADFRGKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKRSLDQDPV
VRTHEIRAKVKELNNVCEPVVTQPKPKIESPKLERTPNGPNIDKKEDLEGKNNLGAEAPH
QNGECHPNEKGSVNMDLD
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgtcggtggttgggctagacgtaggctcacagagctgctacattgcggtggcgcgggcc
gggggcatcgagaccatcgccaacgagttcagcgaccgctgcaccccgtcagtcatatca
tttggatcaaaaaacagaacaattggagttgcagccaaaaaccagcaaatcactcatgca
aacaatacggtctctagctttaagagatttcatggcagagcattcaatgaccccttcatt
cagaaggaaaaggagaacctgagctatgatttggtcccaatgaaaaatggtggcgtggga
ataaaggtcatgtacatggatgaagaacatttcttcagtgtggagcagataacagccatg
ctgctgactaagttaaaggaaactgcagaaaacaacctcaagaagccagtgacagactgt
gtcatctcagtcccatccttcttcacagatgctgagcgaaggtctgtgctggatgctgcg
cagattgtgggcttgaactgcttgcggctcatgaatgacatgacggctgttgctttgaat
tatgggatttataagcaagatctcccgaatgccgaggagaagccacgggtggtggtgttt
gttgacatgggacactcatctttccaagtgtctgcctgtgcttttaacaaaggaaaactg
aaggttctaggcacagcttttgatcccttcttaggaggaaagaactttgatgagaagcta
gtagaacatttttgtgctgaatttaaaaccaagtacaaattggatgcaaaatccaaaatt
cgagccctccttcgtctccatcaggagtgtgaaaagttgaaaaagctcatgagttctaac
agcacggacctgccgctgaacatcgagtgctttatgaatgacaaggatgtctctgggaag
atgaacaggtcacagtttgaagaactgtgtgctgagctcctgcaaaaaatagaggtcccc
cttcactcgttgatggcacagactcagctcaaggctgaagatgtgagtgccattgagata
gtgggaggtgccacaagaatcccagctgtgaaagaaagaattgccaagttctttggaaaa
gatgtcagcaccacgctcaatgcagacgaagctgtggccagaggctgtgcactgcagtgt
gcaattctttctccggcatttaaagttagagagttctctgtcaccgatgcagttcctttt
ccaatatctctggtctggaaccacgactcggaagaaacggaaggtgtgcacgaggtgttc
agtcggaaccatgctgctcctttctccaaagtgctcaccttcctgagaagggggcccttt
gagctagaagctttctattctgaccctcaaggagttccatatccagaagcaaaaataggc
cgttttgttgttcagaatgtttctgcacagaaagatggagagaagtcgagagtgaaggtc
aaagtgcgtgtgaacacacatggcatcttcaccatctccacggcttccatggtggagaag
gtcccgaccgaggaagaggatggctcctctctcgaggcagacatggaatgtccaaaccag
aggccaacagaaagctcggatgtggataaaaatatccagcaagacaacagtgaagctgga
acacagccccaggtacaaactgatggtcaacaaacctcacagtctcccccttcacctgaa
cttacctcagaagaaagcaaaaccccagatgctgacaaagcaaatgaaaagaaagttgat
cagcctccagaagccaagaaacctaaaataaaggtggtaaatgttgagctgcctgtagaa
gccaacttggtatggcagttagggagagaccttcttaacatgtatattgagacagagggc
aagatgatcatgcaagacaagctggagaaggagcggaacgacgccaagaacgccgtggag
gagtgtgtatatgagttcagggacaagctatgtggaccatatgagaaattcatatgtgag
caggaacatgagaagttcttgaggcttctaacagagacggaagactggctgtatgaggaa
ggggaggaccaggctaagcaggcatacattgacaagttggaagagctgatgaaaatgggc
actcctgttaaagtcagatttcaagaagctgaggaacgaccgaaagtgttggaggagctg
gggcagcgcctgcagcactatgccaagattgcagcggacttcagaggcaaggatgagaaa
tacaaccacattgatgaatcagaaatgaagaaggttgagaagtctgttaatgaggtgatg
gagtggatgaataatgtcatgaatgctcaggctaaaagaagtcttgatcaagaccctgtt
gttcgaactcatgaaatcagagcgaaggtcaaggaattgaacaatgtttgtgaacctgtt
gtaactcaacccaaaccaaaaatcgagtcacctaaactggagagaactccaaatggccca
aatattgacaagaaagaagatttagaaggcaaaaataatcttggtgctgaagctccgcat
cagaatggtgaatgccaccctaatgagaagggctctgtcaacatggacctggactag

KEGG   Mus musculus (mouse): 18415
Entry
18415             CDS       T01002                                 

Gene name
Hspa4l, 94kD, 94kDa, AI461691, APG, APG-1, Os, Osp94
Definition
(RefSeq) heat shock protein 4 like
  KO
K09485  heat shock protein 110kDa
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18415 (Hspa4l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18415 (Hspa4l)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP110
   18415 (Hspa4l)
SSDB
Motif
Pfam: HSP70 MreB_Mbl
Other DBs
NCBI-GeneID: 18415
NCBI-ProteinID: NP_035150
MGI: 107422
Ensembl: ENSMUSG00000025757
Vega: OTTMUSG00000023568
UniProt: P48722
Position
3; 3 B
AA seq 838 aa
MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNV
RNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSTGVKVRYLEEERPFAIEQVTGM
LLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALA
YGIYKQDLPSLDEKPRNVVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLGGRNFDEAL
VDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSK
MNRAQFEQLCASLLARVEPPLKSVMDQANLQREDINSIEIVGGATRIPAVKEQVTRFFLK
DISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSVTLRWKTSFEEGTGECEVF
SKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDPRIGNFTIQNVFPQSDGDSSKVKV
KVRINIHGIFSVASASVIEKQNLEGDHNDAAMETEAPKSEGKEDVDKMQVDQEEGGHQKC
HAEHTPEEEIDHTGAKAKAPPSDKQDRINQTIKKGKIKSIDLPIQSSLYRQLTQDLLNSY
IENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDKLGTVYEKFITPEDMNKLSAMLEDTEN
WLYEEGEDQPKQVYVDRLQELKKYGQPIQMKYVEHEERPKALNDLGKKIQLVLKVIEAHR
NKDERYDHLDPAEMERVEKYISDSMNWLNSKMNAQNKLSLTQDPVVKVSEIVTKSKELDN
FCNPIVYKPKPKVEAPEDKAKTGSEHNGPMDGQSGSETSPDPPKGSSQHTDSGEMEVD
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgtcggtggtgggcattgacctcggcttcctcaactgctacatcgctgtagcgaggagc
ggcggcatcgagaccatcgccaacgagtacagcgacaggtgcacgccggcctgtatatct
ttgggatccagaactcgagccattggaaatgcagctaagagccagatagtcacaaatgta
agaaatacaattcatggcttcaaaaagcttcatgggcgatcatttgatgaccccattgtg
caaacggagaggatcaggcttccgtacgagctgcagaagatgcctaatggaagtacaggt
gttaaggtgcggtacctggaagaagagcggccctttgcaattgagcaagtcactgggatg
ttgctggctaagcttaaagagacctcagaaaatgctctgaagaagccagtggctgactgt
gtgatctcgatcccgagctttttcaccgacgcagagagaagatccgtgatggccgcagcc
caggttgcaggcctaaactgtctgaggctgatgaatgaaaccactgcagttgcactggca
tatggaatttataagcaggatcttccctcattagatgagaaaccaaggaatgttgtgttt
atcgacatgggacattctgcctaccaggtctctgtttgtgcttttaacaaaggaaaactg
aaagtgttggctactacctttgacccatatttgggtggcaggaactttgatgaggcttta
gtagactacttctgcgatgaattcaagaccaaatataagataaatgtcaaagagaactcg
cgggccttgttgcggctgtatcaggagtgtgaaaaactaaagaagctgatgagtgcaaac
gcgtcagaccttcccctgaacatcgagtgtttcatgaatgaccttgatgtttctagtaag
atgaacagggctcaatttgagcagttgtgtgcttccctcttagccagggttgaaccacct
ttaaaatcagtaatggatcaagctaacttacaacgtgaagacataaacagcatagagatt
gtgggaggggccacacggattcctgcagtcaaggagcaggtgactaggttctttctgaaa
gacatcagtaccaccctgaatgctgatgaagctgtcgcccgaggatgtgcgttgcagtgt
gcgattctctcaccagcatttaaagtacgtgaattttccataactgaccttgttccttac
tcagtcacattaaggtggaagacttcttttgaagaagggactggggaatgtgaagtcttc
tctaagaaccacccggccccattctcaaaggtcataactttccacaagaaggaaccattt
gaactagaagcattttatactaatttgcatgaagtgccttatcctgatccaagaattgga
aacttcactattcagaatgttttcccacagtctgatggtgacagttctaaagtaaaagtt
aaagttcgtattaatatccatggaatcttcagtgtggccagtgcgtcagtaattgagaag
cagaatctggaaggtgatcataacgatgccgctatggagacggaagctcctaagagtgaa
ggcaaagaggatgtggacaaaatgcaggttgaccaagaagaaggaggtcatcagaaatgt
catgctgagcacaccccagaagaggagattgaccacaccggggccaaagcaaaggcacct
ccttcagataagcaagatcgcataaatcaaactattaaaaaagggaaaatcaagagtatt
gatctacctatccagagtagcctctacagacagctgactcaagaccttctcaatagttac
attgaaaatgaggggaagatgataatgcaggataaattagagaaagaaagaaatgatgct
aaaaatgctgttgaagaatacgtctatgatttcagagacaaattgggcactgtctacgaa
aagttcatcactccagaagacatgaataagctgtctgcaatgttagaagacacagaaaat
tggctgtatgaagaaggagaagaccagcctaaacaagtttatgtggataggctgcaggaa
ttaaagaaatatggccagcccattcaaatgaagtacgtggagcatgaagagagaccaaaa
gctttaaatgacttggggaaaaagattcagcttgtcctgaaagtgatagaagcacacaga
aacaaggatgaaagatatgatcatctggatcctgctgaaatggaaagagttgaaaagtac
atcagtgactccatgaactggctaaacagtaagatgaatgcacagaataaattaagtctc
actcaagatcccgtggtaaaagtgtcagaaatagttacaaagtcaaaggaactggataat
ttctgtaaccccatcgtttataagcccaaaccaaaagtagaagctcctgaagacaaagca
aaaactggtagtgagcacaatggaccaatggacggacagagtggttcagagaccagccca
gatccacccaaaggaagctcacagcacaccgactccggagagatggaagtggactaa

KEGG   Mus musculus (mouse): 213539
Entry
213539            CDS       T01002                                 

Gene name
Bag2, 2610042A13Rik, BC016230
Definition
(RefSeq) BCL2-associated athanogene 2
  KO
K09556  BCL2-associated athanogene 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    213539 (Bag2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    213539 (Bag2)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  BAG
   213539 (Bag2)
SSDB
Motif
Pfam: AMP-binding_C_2 PLAC9 AAA_13
Other DBs
NCBI-GeneID: 213539
NCBI-ProteinID: NP_663367
MGI: 1891254
Ensembl: ENSMUSG00000042215
Vega: OTTMUSG00000021814
UniProt: Q91YN9
Structure
PDB: 
3CQX 3D0T

Position
1; 1 B
AA seq 210 aa
MAQAKISAKAHEGRFCRSSSMADRSSRLLESLDQLELRVEALRDAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQEESLKHATRIIDEV
VSKFLDDLGNAKSHLMSLYSACSSEVPPGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IDNSDKAIKLLEHAKGAGSKSLQNTDGKFN
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcccaggcgaagatcagcgccaaggcccacgagggccgcttctgccgctcgtcttcc
atggccgaccgctccagccgcctgctggagagtctggaccagctggagctcagggtggaa
gctttgagagacgcagctactgctgttgagcaggagaaagaaatccttctggagatgatc
cacagtatccaaaacagccaggacatgaggcagattagcgatggagaaagagaggaacta
aacctgactgccaaccgtctgatgggccggaccctcacggttgaggtctcggtggaaacg
atccgaaacccccagcaggaggaatccttgaagcatgccacgaggattatagacgaggtg
gtcagcaagttcctagatgacctggggaatgccaagagccacttaatgtcactttacagt
gcctgctcatcggaggtgccgcctgggccggtggaccagaagtttcaatcgatagtcatc
ggttgcgctcttgaggatcagaagaaaatcaagaggcgattggagactctgctgaggaac
attgacaactccgacaaggccattaaactcctagagcatgctaaaggagctggttccaaa
agcctgcagaacactgacggcaaatttaattag

KEGG   Mus musculus (mouse): 66245
Entry
66245             CDS       T01002                                 

Gene name
Hspbp1, 1500019G21Rik
Definition
(RefSeq) HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1
  KO
K09562  hsp70-interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66245 (Hspbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    66245 (Hspbp1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   66245 (Hspbp1)
SSDB
Motif
Pfam: Fes1 Arm HEAT_EZ Rcd1 CLIP_SPH_mas PPTA
Other DBs
NCBI-GeneID: 66245
NCBI-ProteinID: NP_077134
MGI: 1913495
Ensembl: ENSMUSG00000063802
Vega: OTTMUSG00000058444
UniProt: Q99P31
Position
7; 7 A1
AA seq 357 aa
MADKGSGGSRLPLALPPASQGCSSGGSGSSAGGSGNPRPPRNLQGLLQMAITAGSQEPDP
PPEPMSEERRQWLQEAMSAAFRGQREEVEQMKNCLRVLSQATPAMAGEAELATDQQEREG
ALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQ
VLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQ
VQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTD
FPQGVRECREPELGLEELLRHRCQLLQQREEYQEELEFCEKLLQTCFSSPTDDSMDR
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcagacaaaggctcagggggcagtcgcctccctcttgcgttgcctccggcctctcag
ggttgctcgtcagggggcagtggttcctcggcggggggctcaggcaacccccggcctcca
cggaacctccaaggcctgctgcagatggctattactgcgggttctcaggagccagacccc
cctccagaacccatgagcgaggagagacgccaatggctgcaggaagccatgtcggccgcc
ttccggggccagcgagaggaggtggagcagatgaagaactgcctccgggtcctgtcccag
gccacacccgcaatggctggcgaagctgagctggccactgaccagcaggagcgtgaaggc
gcactagagctgctggcagacctgtgcgagaacatggacaatgcagcagatttctgccag
ctgtcaggcatgcatctgctggtgggtcgatacctggaggcaggggctgcagggctgcgc
tggagggcagcacaactcatcggcacatgcagtcagaacgttgcagccatccaggagcag
gtgttgggcttgggtgccctgcgcaagctacttcggctgctcgaccgggactcctgcgac
acggtacgagtcaaggctctcttcgccatctcctgtcttgtccgagagcaggaggctggg
ttgctgcagttcctccgcctggatggattctcagtgctgatgcgggccatgcagcagcaa
gtgcagaagctcaaggtcaagtcagcattcctgctgcagaacttgctggtgggccaccct
gagcacaaaggaaccctttgctccatggggatggtccagcagctggtggcccttgtgagg
acagaacacagtcctttccatgagcatgtgcttggagccctgtgcagccttgtgacagat
ttccctcagggtgttcgtgaatgccgggagcctgagctgggcctggaggaactgctccgc
caccgctgccagctgctgcagcagcgtgaggagtaccaggaggagctggagttctgtgaa
aagctgttacagacctgtttctctagccctaccgacgacagcatggatcgctga

DBGET integrated database retrieval system