KEGG   Mus musculus (mouse): 12018Help
Entry
12018             CDS       T01002                                 

Gene name
Bak1, Bak, N-BAK1, N-Bak
Definition
(RefSeq) BCL2-antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12018 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12018 (Bak1)
   04215 Apoptosis - multiple species
    12018 (Bak1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    12018 (Bak1)
   05202 Transcriptional misregulation in cancer
    12018 (Bak1)
   05206 MicroRNAs in cancer
    12018 (Bak1)
   05203 Viral carcinogenesis
    12018 (Bak1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    12018 (Bak1)
   05212 Pancreatic cancer
    12018 (Bak1)
   05225 Hepatocellular carcinoma
    12018 (Bak1)
   05226 Gastric cancer
    12018 (Bak1)
   05214 Glioma
    12018 (Bak1)
   05216 Thyroid cancer
    12018 (Bak1)
   05220 Chronic myeloid leukemia
    12018 (Bak1)
   05217 Basal cell carcinoma
    12018 (Bak1)
   05218 Melanoma
    12018 (Bak1)
   05213 Endometrial cancer
    12018 (Bak1)
   05224 Breast cancer
    12018 (Bak1)
   05222 Small cell lung cancer
    12018 (Bak1)
   05223 Non-small cell lung cancer
    12018 (Bak1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    12018 (Bak1)
   05163 Human cytomegalovirus infection
    12018 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12018 (Bak1)
   05169 Epstein-Barr virus infection
    12018 (Bak1)
   05165 Human papillomavirus infection
    12018 (Bak1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    12018 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12018 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    12018 (Bak1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    12018 (Bak1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   12018 (Bak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2
Motif
Other DBs
NCBI-GeneID: 12018
NCBI-ProteinID: NP_031549
MGI: 1097161
Ensembl: ENSMUSG00000057789
Vega: OTTMUSG00000030987
UniProt: O08734
Structure
PDB: 

Position
17; 17 A3.3
AA seq 209 aa AA seqDB search
MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDN
LPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALN
FRRDPILTVMVIFGVVLLGQFVVHRFFRS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggacaaggaccaggtcccccgaaggtgggctgcgatgagtccccgtcccct
tctgaacagcaggttgcccaggacacagaggaggtctttcgaagctacgttttttacctc
caccagcaggaacaggagacccagggggcggccgcccctgccaaccccgagatggacaac
ttgcccctggaacccaacagcatcttgggtcaggtgggtcggcagcttgctctcatcgga
gatgatattaaccggcgctacgacacagagttccagaatttactagaacagcttcagccc
acagccgggaatgcctacgaactcttcaccaagatcgcctccagcctatttaagagtggc
atcagctggggccgcgtggtggctctcctgggctttggctaccgtctggccctgtacgtc
taccagcgtggtttgaccggcttcctgggccaggtgacctgctttttggctgatatcata
ctgcatcattacatcgccagatggatcgcacagagaggcggttgggtggcagccctgaat
tttcgtagagaccccatcctgaccgtaatggtgatttttggtgtggttctgttgggccaa
ttcgtggtacacagattcttcagatcatga

DBGET integrated database retrieval system