KEGG   Mus musculus (house mouse): 12023
Entry
12023             CDS       T01002                                 
Symbol
Barx2, 2310006E12Rik, Barx2b
Name
(RefSeq) BarH-like homeobox 2
  KO
K09361  BarH-like homeobox
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12023 (Barx2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    12023 (Barx2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 12023
NCBI-ProteinID: NP_038828
MGI: 109617
Ensembl: ENSMUSG00000032033
UniProt: O08686
Position
9:complement(31757340..31824581)
AA seq 283 aa
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS
CTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTPVLTRHPVAAAEAAAAAAETPGGEAL
ASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQ
VKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLES
SERQEEPCDTQEPKACLVPLEVAEPIHQPQELSEASSEPPPLS
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcactgccacgcggaactgaggctgagctcacccggccagctcaaagcagccaggcgg
cgctacaagactttcatgatcgatgagatcctctccaaggagacctgcgactactttgag
aaactttccctctactctgtgtgcccgtcgctggtggtgcgacccaagcccctgcactct
tgtaccggttccccttccctacgggcatatcctctcctgtctgtgatcacccggcagccc
acagtcatctcccacctggttcccaccggctcgggactcaccccagtgttaactcgccat
ccagtcgccgctgcggaggcggcggctgctgctgctgagacccctggtggtgaggcgtta
gccagcagcgagtcagagacagaacagcccacgcccaggcagaagaaaccacgcagaagt
cgcaccatcttcaccgagctgcagctcatgggcctagagaagaaattccagaagcagaag
tatttgtctaccccagacaggttggacttggcccagtctctgggactcactcagctgcaa
gtgaagacttggtatcagaatcgcaggatgaaatggaagaagatggtccttaaaggtgga
caggaagcacccacaaaacctaaggggcgccctaagaagaattccattcccacatcagag
gagattgaagctgaagagaagatgaacagccaggctcagagccaggagctgctggaatcc
tcggagagacaggaggagccctgtgatacccaggagcccaaagcgtgccttgtccccttg
gaggtggcagaacctattcaccagccccaggagttatcagaagcttcctctgaaccccca
ccattaagctaa

DBGET integrated database retrieval system