KEGG   Mus musculus (house mouse): 12033
Entry
12033             CDS       T01002                                 
Symbol
Bcap29, Bap29
Name
(RefSeq) B cell receptor associated protein 29
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Bap31 Bap31_Bap29_C Lebercilin PolyA_pol_arg_C APG6_N
Other DBs
NCBI-GeneID: 12033
NCBI-ProteinID: NP_001157562
MGI: 101917
Ensembl: ENSMUSG00000020650
UniProt: Q61334 Q542A1
Position
12:complement(31645353..31684657)
AA seq 240 aa
MTIQWAAVASFLYAEIGLILLFCLPFIPPQRWQKIFSFSVWGKIASFWNKAFLTIIILLI
ILFLDAVREVRKYSSTNVVEKNSAIRPSAFEHTQMKLFRSQRNLYISGFSLFFWLVLRRL
VTLITQLAKEIANKGVLKIQAENTNKAAKKFMEENEKLKLGLRNDNAEEHLLEAENKKLI
ESKENLKTELKKASDALLKAQNDVMTMKIQSERLSKEYDRLLKEHSELQNRLEKEKKKGL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacaatccaatgggcggcggttgccagctttctttatgctgaaataggactcatttta
ctcttctgtctgccctttattcctccacagagatggcagaagattttttcatttagtgtc
tggggtaagattgcaagtttttggaacaaagcttttcttaccattataatactattgatc
attctgtttctagatgccgtgagagaagtaagaaagtattcgtccacgaatgttgtagag
aagaactcagccatcagaccgagtgcctttgagcacacacagatgaagctcttcaggtct
caaagaaatctgtatatttctggattctcattatttttttggctagtgttgagacgtctg
gttacgcttattactcagctggcaaaagaaatagcaaacaaaggagtgcttaaaattcaa
gcagaaaataccaataaggctgccaagaaattcatggaagagaatgaaaaactaaaattg
gggctaagaaatgacaatgctgaagaacaccttttggaagctgaaaataaaaaactaata
gaaagcaaggagaacctgaaaaccgagctgaagaaggcttccgatgcccttttgaaggcc
caaaatgatgtcatgactatgaagattcagtcagagagactttctaaagagtatgaccga
ctcctgaaagaacactcagaacttcagaaccgtttagagaaagagaagaagaaaggcctg
tga

DBGET integrated database retrieval system