KEGG   Mus musculus (mouse): 12035Help
Entry
12035             CDS       T01002                                 

Gene name
Bcat1, BCATc, Eca39
Definition
(RefSeq) branched chain aminotransferase 1, cytosolic
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00290  Valine, leucine and isoleucine biosynthesis
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    12035 (Bcat1)
   00280 Valine, leucine and isoleucine degradation
    12035 (Bcat1)
   00290 Valine, leucine and isoleucine biosynthesis
    12035 (Bcat1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    12035 (Bcat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    12035 (Bcat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     12035 (Bcat1)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class IV
   12035 (Bcat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 12035
NCBI-ProteinID: NP_031558
MGI: 104861
Ensembl: ENSMUSG00000030268
Vega: OTTMUSG00000025302
UniProt: P24288 Q3TJN1
Position
6 G3; 6 77.27 cM
AA seq 386 aa AA seqDB search
MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTV
EWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRM
CRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSK
ALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVEN
GCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQ
WGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPK
LASRILGKLTDIQYGRVESDWTIELP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactgcagtaatggatgctccgcgccgtttgctggagaaagaggatcagaagaa
gtggcggagacttttagggccaaagatctcatcatcacaccagccactgtcttaaaagag
aagccggacccggattcgctggtctttggagctacgtttactgaccacatgctgacggtg
gagtggtcctctgcgtctggatgggagaaacctcacattaagccttttggaaacttgccc
atacatcccgctgcctctgttttgcactacgctgtggaactgtttgaaggcttgaaagcc
tttcggggagttgataacaagatccgattgttccggccggacctcaacatggatagaatg
tgccgatctgctgtgaggaccacgctgccgatgtttgacaaggaggagctcctaaagtgt
attcttcagcttctacagatcgaccaagaatgggttccctactccacctctgccagcctc
tacatccgccccacatttatcggaactgagccatctcttggcgtcaagaagccttccaaa
gccctactctttgtgatcctgagccccgtgggaccttatttttctagtggatcttttact
ccggtgtccctgtgggccaatccaaagtacatcagagcctggaaaggtgggactggagac
tgcaagatgggcggcaattatggagcctcccttctggcacagtgcgaggccgtggagaat
ggctgtcagcaggtcctgtggctgtacggcaaggacaaccagataactgaagtaggcaca
atgaatcttttcctctactggataaacgaagacggagaagaggagctggcaacgccccca
ctagatggcatcattctcccaggagtgaccaggcagagcatcctggagctggcacaacag
tggggtgagtttaaggtatgtgagagacacctcaccatggatgacctggccaccgccctt
gaggggaacagagtgaaggagatgttcggctcagggacagcctgcgttgtctgcccagtc
tctgatattctgtacaagggccagatgctgcatattccaacgatggagaatggccccaag
cttgcaagtcgaatcctgggaaagctgactgatatccagtatggaagggtggagagtgac
tggacaatcgagctaccctga

DBGET integrated database retrieval system