KEGG   Mus musculus (mouse): 12039Help
Entry
12039             CDS       T01002                                 

Gene name
Bckdha
Definition
(RefSeq) branched chain ketoacid dehydrogenase E1, alpha polypeptide
  KO
K00166  2-oxoisovalerate dehydrogenase E1 component alpha subunit [EC:1.2.4.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    12039 (Bckdha)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    12039 (Bckdha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     12039 (Bckdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 12039
NCBI-ProteinID: NP_031559
MGI: 107701
Ensembl: ENSMUSG00000060376
Vega: OTTMUSG00000058394
UniProt: Q3U3J1
Position
7; 7 A3
AA seq 446 aa AA seqDB search
MAIVMSAAKIWRPSRGLRQAALLLLGRSGVRGLARSHPSRQQQQQFPSLDDKPQFPGASA
EFVDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEEVLKFYRSMTLLNTMDRIL
YESQRQGRISFYMTNYGEEGTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMSQCY
GNVNDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRIVICYFGEG
AASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVD
GNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDH
PISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQEMPAQ
LRRQQESLARHLQTYGEHYPLDHFDK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagtgatgtctgcggccaagatctggaggccgagccgtggcctgcgccaggct
gctcttctcctgttgggacgatctggggttcggggcttggctagatctcaccccagcagg
cagcagcaacagcagttcccatccctggacgacaagccccagttcccaggggcctctgca
gagtttgtagacaagcttgagttcatccagcccaatgtcatctccggcatccccatctac
cgtgtcatggaccgccagggccagatcatcaaccccagtgaagatccccacctgccccag
gaggaggtgctgaagttctaccggagcatgacgctgctcaacaccatggaccgcattctc
tatgagtcccagcggcagggccggatctccttctacatgaccaactatggcgaggagggg
acacatgtgggcagtgccgctgccttggagcgcacagacctggtgtttggccagtaccgg
gaggcaggtgtgctcatgtaccgggactacccgctggagctgttcatgtcccagtgctac
ggcaacgtgaatgacccaggcaagggacgccagatgcctgttcactacggctgcaaggaa
cgccacttcgtcaccatttcctctccactggccacgcagatccctcaggcggtaggggca
gcctatgctgccaagcgggccaatgccaaccggattgtgatctgttactttggcgagggg
gcagccagtgaaggggatgcccacgccggtttcaatttcgctgccaccctggagtgtccc
atcatcttcttctgccggaacaatggctatgccatctccacaccaacctctgagcagtac
cgtggggatggcatagcggctcggggccctgggtacggcatcatgtcaatccgtgtggac
ggcaacgatgtgtttgctgtgtacaatgccactaaggaggcccgacggcgggctgtggct
gagaaccagcccttcctcattgaggccatgacctacaggattggccaccacagcaccagt
gacgacagctcagcgtaccgttcggtggacgaggtcaattactgggacaagcaggaccac
ccaatctcgaggctgaggcagtacctgctgaaccagggttggtgggatgaggaacaggag
aaggcctggcggaagcagtcacgaaagaaggtcatggaagcctttgagcaggctgagcgg
aagctaaagccgaacccaagcctcctcttctccgatgtgtaccaggagatgcccgcccag
ctccgcaggcagcaggagtcgctggcacggcacctgcagacttacggggagcactacccc
ctggaccactttgacaagtga

DBGET integrated database retrieval system