KEGG   Mus musculus (mouse): 12043Help
Entry
12043             CDS       T01002                                 

Gene name
Bcl2, AW986256, Bcl-2, C430015F12Rik, D630044D05Rik, D830018M01Rik
Definition
(RefSeq) B cell leukemia/lymphoma 2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04115  p53 signaling pathway
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04340  Hedgehog signaling pathway
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04915  Estrogen signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12043 (Bcl2)
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    12043 (Bcl2)
   04630 Jak-STAT signaling pathway
    12043 (Bcl2)
   04064 NF-kappa B signaling pathway
    12043 (Bcl2)
   04066 HIF-1 signaling pathway
    12043 (Bcl2)
   04071 Sphingolipid signaling pathway
    12043 (Bcl2)
   04151 PI3K-Akt signaling pathway
    12043 (Bcl2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    12043 (Bcl2)
  Cell growth and death
   04210 Apoptosis
    12043 (Bcl2)
   04215 Apoptosis - multiple species
    12043 (Bcl2)
   04217 Necroptosis
    12043 (Bcl2)
   04115 p53 signaling pathway
    12043 (Bcl2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    12043 (Bcl2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    12043 (Bcl2)
  Endocrine system
   04915 Estrogen signaling pathway
    12043 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    12043 (Bcl2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12043 (Bcl2)
  Nervous system
   04725 Cholinergic synapse
    12043 (Bcl2)
   04722 Neurotrophin signaling pathway
    12043 (Bcl2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12043 (Bcl2)
   05206 MicroRNAs in cancer
    12043 (Bcl2)
   05210 Colorectal cancer
    12043 (Bcl2)
   05226 Gastric cancer
    12043 (Bcl2)
   05215 Prostate cancer
    12043 (Bcl2)
   05222 Small cell lung cancer
    12043 (Bcl2)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    12043 (Bcl2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    12043 (Bcl2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12043 (Bcl2)
  Infectious diseases
   05152 Tuberculosis
    12043 (Bcl2)
   05161 Hepatitis B
    12043 (Bcl2)
   05169 Epstein-Barr virus infection
    12043 (Bcl2)
   05145 Toxoplasmosis
    12043 (Bcl2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    12043 (Bcl2)
   01524 Platinum drug resistance
    12043 (Bcl2)
   01522 Endocrine resistance
    12043 (Bcl2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12043 (Bcl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 12043
NCBI-ProteinID: NP_033871
MGI: 88138
Ensembl: ENSMUSG00000057329
Vega: OTTMUSG00000022128
UniProt: P10417
Position
1 E2.1; 1 49.76 cM
AA seq 236 aa AA seqDB search
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat
tataagctgtcacagaggggctacgagtgggatgctggagatgcggacgcggcgcccctg
ggggctgcccccacccctggcatcttctccttccagcctgagagcaacccaatgcccgct
gtgcaccgggacatggctgccaggacgtctcctctcaggcccctcgttgccaccgctggg
cctgcgctcagccctgtgccacctgtggtccatctgaccctccgccgggctggggatgac
ttctctcgtcgctaccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg
catctgcacacctggatccaggataacggaggctgggatgcctttgtggaactatatggc
cccagcatgcgacctctgtttgatttctcctggctgtctctgaagaccctgctcagcctg
gccctggtcggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system