KEGG   Mus musculus (mouse): 12044Help
Entry
12044             CDS       T01002                                 

Gene name
Bcl2a1a, A1, BB218357, Bcl2a1, Bfl-1, Hbpa1
Definition
(RefSeq) B cell leukemia/lymphoma 2 related protein A1a
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12044 (Bcl2a1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12044 (Bcl2a1a)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    12044 (Bcl2a1a)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    12044 (Bcl2a1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 DDE_Tnp_1_assoc
Motif
Other DBs
NCBI-GeneID: 12044
NCBI-ProteinID: NP_033872
MGI: 102687
Ensembl: ENSMUSG00000102037
Vega: OTTMUSG00000045614
UniProt: Q07440
Structure
PDB: 

Position
9 E3.1; 9 47.24 cM
AA seq 172 aa AA seqDB search
MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtctgagctcatgcatatccactccctggctgagcactaccttcagtatgtg
ctacaggtacccgcctttgagtcggctccaagccaagcatgcagagtgctacaaagagtt
gctttctccgttcagaaggaagttgaaaagaatctgaagtcatacttggatgactttcac
gtggaatccatagataccgccagaataatattcaaccaagtgatggaaaaagagtttgaa
gatggcatcattaactggggaaggattgtgactatatttgcctttgggggtgttctcctc
aaaaaacttccacaagagcagattgccctggatgtatgtgcttacaaacaagtttccagt
tttgtggcagaattcataatgaataacacaggagaatggatacggcagaatggaggttgg
gaagatggcttcataaagaagtttgaacccaaatctggctggctgacttttctgcagatg
acaggacagatctgggaaatgctctttctcctcaagtaa

DBGET integrated database retrieval system