KEGG   Mus musculus (mouse): 12050
Entry
12050             CDS       T01002                                 

Gene name
Bcl2l2, AW048834, Bcl-w, Gtrgal2, Gtrosa41, bclw, c98
Definition
(RefSeq) BCL2-like 2
  KO
K02163  apoptosis regulator BCL-W
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12050 (Bcl2l2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12050 (Bcl2l2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    12050 (Bcl2l2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12050 (Bcl2l2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   12050 (Bcl2l2)
SSDB
Motif
Pfam: Bcl-2 BH4 ABATE HTH_AsnC-type Apolipoprotein
Other DBs
NCBI-GeneID: 12050
NCBI-ProteinID: NP_031563
MGI: 108052
Ensembl: ENSMUSG00000022194 ENSMUSG00000089682
Vega: OTTMUSG00000032812
UniProt: P70345
Position
14 C2; 14 27.98 cM
AA seq 193 aa
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcgaccccagcctcaaccccagacacacgggctctagtggctgactttgtaggctat
aagctgaggcagaagggttatgtctgtggagctggccctggggaaggcccagccgccgac
ccgctgcaccaagccatgcgggctgctggagacgagtttgagacccgtttccgccgcacc
ttctctgacctggccgctcagctacacgtgaccccaggctcagcccagcaacgcttcacc
caggtttccgacgaacttttccaagggggccctaactggggccgtcttgtggcattcttt
gtctttggggctgccctgtgtgctgagagtgtcaacaaagaaatggagcctttggtggga
caagtgcaggattggatggtggcctacctggagacacgtctggctgactggatccacagc
agtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcacgg
cgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactg
ggggccctggtaactgtaggggccttttttgctagcaagtga

DBGET integrated database retrieval system