KEGG   Mus musculus (mouse): 12053Help
Entry
12053             CDS       T01002                                 

Gene name
Bcl6, Bcl5
Definition
(RefSeq) B cell leukemia/lymphoma 6
  KO
K15618  B-cell lymphoma 6 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12053 (Bcl6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12053 (Bcl6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12053 (Bcl6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    12053 (Bcl6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-met zf-C2H2_4 zf-C2H2_jaz DZR zf-C2HE Zn-ribbon_8 zf-C2H2_6 DUF3342
Motif
Other DBs
NCBI-GeneID: 12053
NCBI-ProteinID: NP_001334955
MGI: 107187
Ensembl: ENSMUSG00000022508
Vega: OTTMUSG00000027148
UniProt: P41183 Q544F9
Position
16 B1; 16 15.26 cM
AA seq 707 aa AA seqDB search
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEISPEGFCILLDFMYTSRLNLREGNIMAVMTTAMYLQMEHVVDT
CRKFIKASEAEMAPALKPPREEFLNSRMLMPHDIMAYRGREVVENNMPLRNTPGCESRAF
APPLYSGLSTPPASYPMYSHLPLSTFLFSDEELRDAPRMPVANPFPKERALPCDSARQVP
NEYSRPAMEVSPSLCHSNIYSPKEAVPEEARSDIHYSVPEGPKPAVPSARNAPYFPCDKA
SKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQAS
GSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGSEQAELGRLSPRAYPAPPACQPPME
PANLDLQSPTKLSASGEDSTIPQASRLNNLVNRSLAGSPRSSSESHSPLYMHPPKCTSCG
SQSPQHTEMCLHTAGPTFPEEMGETQSEYSDSSCENGTFFCNECDCRFSEEASLKRHTLQ
THSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGE
KPYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYH
CEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSAADLPPELPKAC
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcctccccggctgacagctgtatccagtttacccggcacgctagtgatgttcttctc
aaccttaatcgcctccggagtcgggacatcttgacggacgttgtcatcgtggtgagccgt
gagcagtttagagcccataagacagtgctcatggcctgcagcggcctgttctacagtatc
ttcactgaccagttgaaatgcaaccttagtgtaatcaatctagatcctgaaatcagccct
gaggggttttgcatcctcctggacttcatgtacacatctaggctcaacctgagggaaggc
aatatcatggcggtgatgaccacagccatgtacctgcagatggagcatgttgtcgacaca
tgcaggaagttcatcaaggccagtgaagcagaaatggcccctgcacttaaacctccccgt
gaagagttcctgaacagccggatgctgatgccccatgacatcatggcctaccgaggtcgt
gaggtcgtggagaacaatatgccactgagaaatactcccgggtgtgagagcagagctttt
gctcctcctctgtacagtggcctgtcaacaccaccagcctcttatcccatgtacagccat
ctcccgctcagcaccttcctcttctctgatgaggagctccgagatgccccccgaatgcct
gtggccaacccttttcccaaggagcgtgccctcccctgcgacagtgccaggcaagtccct
aatgagtatagcaggccagccatggaggtgtcccccagtttgtgtcacagcaacatctac
tcgcccaaggaggcagtcccagaggaggctcggagtgacatacactacagtgtgcctgag
ggccccaagcctgctgtcccttctgctcggaatgctccatacttcccctgtgacaaagcc
agcaaagaagaagagagaccttcttcggaggatgagattgccctgcatttcgagcccccc
aatgcacccttgaaccggaagggtctggttagtccccagagtccccagaaatccgactgc
cagcccaactcacccacagagtcctgcagcagcaagaacgcctgcatccttcaggcctct
ggctctccgccagccaagagccccactgacccgaaagcctgcaactggaagaagtataag
ttcatcgttctcaacagcctcaatcagaatgccaaacccgagggctctgagcaggcagag
ctgggtcgcctctcccctcgagcctaccctgcaccgcccgcttgccagccgcctatggag
cccgcgaaccttgatctccagtccccgaccaagctcagtgccagtggggaggactctacc
atcccccaagccagccggctcaataatctcgtgaacaggtccctggcaggctccccccga
agcagcagtgagagtcactcaccactctacatgcaccccccaaagtgcacatcctgcggc
tctcagtccccacagcatacagagatgtgcctccatactgctgggcccacgttcccggag
gagatgggggaaacccagtcagagtattcggattctagctgtgagaatgggaccttcttc
tgcaacgaatgtgactgccgtttctctgaggaggcctcgctcaagaggcacacgctgcag
acgcacagtgacaaaccatacaaatgtgatcgctgccaggcctccttccgctacaagggc
aacctcgccagccacaagactgtccacacgggtgagaaaccctatcgctgtaacatttgt
ggagcgcagttcaatcggccagccaacctgaagacccacactcgaattcactctggagaa
aagccctacaaatgtgaaacctgtggggccaggtttgttcaggtggcccacctccgtgcc
cacgtgctcatccacactggagagaagccgtacccctgtgaaatctgtggcactcgcttc
cggcaccttcagactctgaagagccatctgcgcatccacacaggagagaaaccttaccat
tgtgagaagtgtaacctgcactttcgtcacaaaagccaactgcgacttcatttgcgccag
aagcacggcgccatcaccaacaccaaggtgcaataccgcgtgtcggccgctgacctgcct
ccggagctccccaaagcctgctga

DBGET integrated database retrieval system