KEGG   Mus musculus (mouse): 12062
Entry
12062             CDS       T01002                                 

Gene name
Bdkrb2, B(2), B2, B2R, BK-2, BK2, BK2R, BKR2, BRB2
Definition
(RefSeq) bradykinin receptor, beta 2
  KO
K03916  bradykinin receptor B2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05142  Chagas disease
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12062 (Bdkrb2)
   04071 Sphingolipid signaling pathway
    12062 (Bdkrb2)
   04022 cGMP-PKG signaling pathway
    12062 (Bdkrb2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12062 (Bdkrb2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12062 (Bdkrb2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12062 (Bdkrb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    12062 (Bdkrb2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    12062 (Bdkrb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12062 (Bdkrb2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12062 (Bdkrb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12062 (Bdkrb2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Bradykinin
    12062 (Bdkrb2)
SSDB
Motif
Pfam: 7tm_1 DUF2976
Other DBs
NCBI-GeneID: 12062
NCBI-ProteinID: NP_033877
MGI: 102845
Ensembl: ENSMUSG00000021070
UniProt: P32299
Position
12 E; 12 55.76 cM
AA seq 392 aa
MPCSWKLLGFLSVHEPMPTAASFGIEMFNVTTQVLGSALNGTLSKDNCPDTEWWSWLNAI
QAPFLWVLFLLAALENLFVLSVFFLHKNSCTVAEIYLGNLAAADLILACGLPFWAITIAN
NFDWVFGEVLCRVVNTMIYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSL
VIWGCTLLLSSPMLVFRTMREYSEEGHNVTACVIVYPSRSWEVFTNVLLNLVGFLLPLSV
ITFCTVRILQVLRNNEMKKFKEVQTERKATVLVLAVLGLFVLCWVPFQISTFLDTLLRLG
VLSGCWDEHAVDVITQISSYVAYSNSGLNPLVYVIVGKRFRKKSREVYRVLCQKGGCMGE
PVQMENSMGTLRTSISVERQIHKLQDWAGKKQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgccctgctcctggaagctactcgggtttctgtcggtgcatgagcccatgcccaccgcg
gcctcctttggcatcgaaatgttcaacgtcaccacacaagtcctcgggtctgctcttaac
gggaccctttcgaaggacaactgcccagacaccgagtggtggagttggctcaatgccatc
caggcccccttcctctgggtcctcttcctgctggccgcactggagaacctctttgtcctc
agcgtgttcttcctgcacaaaaacagctgcactgtggccgagatctacctgggcaacctg
gcagcggcggacctcatcctggcctgcgggttacctttctgggccatcaccatcgccaat
aactttgactgggtgtttggagaggtgttgtgccgggtggtgaacaccatgatctacatg
aacctgtacagcagcatctgcttcctgatgctcgtgagtatcgaccgctacctggcgctg
gtgaagaccatgtccatgggccggatgcgcggggtgcgctgggccaaactctacagcctg
gtgatctggggctgtacactgcttctgagttcacccatgttggtgttcaggaccatgagg
gaatacagcgaagagggccacaatgtcaccgcctgcgtcatcgtctacccgtcccgttcc
tgggaggtgttcaccaacgtgctgctgaacctggtgggtttcctcctgcccctgagcgtc
atcaccttctgcacggtgcgcatcttgcaggtgctgaggaacaacgagatgaagaagttc
aaggaggtccagacggagaggaaggccaccgtgctagtgctggccgtcctggggctcttt
gtgctgtgttgggtgcctttccagatcagcaccttcctggacacgctgctgcgcctcggc
gtgctgtccggatgctgggacgagcacgccgtagacgtcatcacgcagatcagttcctac
gtggcctacagcaacagcggcctcaacccactggtgtacgtgatcgtgggcaagcgcttc
cggaagaagtcccgagaggtgtaccgggtgctgtgccagaaaggaggctgcatgggagaa
cccgtccagatggagaactccatggggactttgagaacctcgatctccgtggaacggcag
atccacaagctgcaggactgggcagggaagaaacagtga

DBGET integrated database retrieval system