KEGG   Mus musculus (mouse): 12064
Entry
12064             CDS       T01002                                 

Gene name
Bdnf
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12064 (Bdnf)
   04014 Ras signaling pathway
    12064 (Bdnf)
   04024 cAMP signaling pathway
    12064 (Bdnf)
   04151 PI3K-Akt signaling pathway
    12064 (Bdnf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12064 (Bdnf)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    12064 (Bdnf)
   05022 Pathways of neurodegeneration - multiple diseases
    12064 (Bdnf)
  09165 Substance dependence
   05030 Cocaine addiction
    12064 (Bdnf)
   05034 Alcoholism
    12064 (Bdnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12064 (Bdnf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   12064 (Bdnf)
SSDB
Motif
Pfam: NGF NTF3_N Spaetzle
Other DBs
NCBI-GeneID: 12064
NCBI-ProteinID: NP_001041604
MGI: 88145
Ensembl: ENSMUSG00000048482
Vega: OTTMUSG00000015122
UniProt: P21237 Q541P3
Position
2 E3; 2 56.63 cM
AA seq 249 aa
MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggcggcgccc
atgaaagaagtaaacgtccacggacaaggcaacttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacatca
ctggctgacacttttgagcacgtcatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctactctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccctgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtctggcgggacggtcacagtcctagagaaagtcccggtatccaaaggccaactgaag
cagtatttctacgagaccaagtgtaatcccatgggttacaccaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

DBGET integrated database retrieval system