KEGG   Mus musculus (mouse): 12068
Entry
12068             CDS       T01002                                 

Gene name
Bet1, AW555236, Bet-1
Definition
(RefSeq) Bet1 golgi vesicular membrane trafficking protein
  KO
K08504  blocked early in transport 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    12068 (Bet1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12068 (Bet1)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    12068 (Bet1)
SSDB
Motif
Pfam: Sec20 Use1 DUF4407
Other DBs
NCBI-GeneID: 12068
NCBI-ProteinID: NP_033878
MGI: 1343104
Ensembl: ENSMUSG00000032757
Vega: OTTMUSG00000023841
UniProt: O35623
Position
6; 6 A1
AA seq 118 aa
MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQ
NKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaggcgtgcaggcctgggtgatggagcacctcctggcagctatgggaactatggctat
gccaatactggttataatgcttgtgaagaagagaatgacagactcactgaaagtctgaga
agcaaagtaacggctataaaatctctttccattgaaataggccatgaagttaaaaatcaa
aacaaactattagctgaaatggattcacaatttgattctacaactggatttctaggtaaa
accatgggaagactgaagattttgtccagagggagccaaacaaaattgctatgctatatg
atgctgttttcattgtttgtcttttttgtcatttattggattattaaactgaggtga

DBGET integrated database retrieval system