KEGG   Mus musculus (mouse): 12070
Entry
12070             CDS       T01002                                 

Symbol
Bex3, AL033356, DXWsu67e, Gcap27, Nade, Ngfrap1
Name
(RefSeq) brain expressed X-linked 3
  KO
K12465  nerve growth factor receptor-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12070 (Bex3)
SSDB
Motif
Pfam: BEX
Other DBs
NCBI-GeneID: 12070
NCBI-ProteinID: NP_001103703
MGI: 1338016
Ensembl: ENSMUSG00000046432
Vega: OTTMUSG00000018688
UniProt: Q9WTZ9
Position
X F1; X 57.64 cM
AA seq 124 aa
MANVHQENEEMEQPLQNGQEDRPVGGGEGHQPAANNNNNNHNHNHNHHRRGQARRLAPNF
RWAIPNRQMNDGLGGDGDDMEMFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
CLMP
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccaatgtccaccaggaaaacgaagagatggagcagcccctgcagaatggacaggaa
gaccgccctgtgggaggaggtgagggccaccagcctgctgcaaacaacaacaacaacaac
cacaaccataaccacaaccaccaccgaagaggccaggctcgccgacttgcccctaacttc
cgatgggccattcccaacaggcagatgaatgacgggttgggtggagatggagatgatatg
gaaatgttcatggaggagatgagagagatccggagaaagcttagggagctacagctgaga
aattgtctacgcatccttatgggggagctgtctaaccaccacgatcaccatgatgaattc
tgccttatgccttga

DBGET integrated database retrieval system