KEGG   Mus musculus (mouse): 12091Help
Entry
12091             CDS       T01002                                 

Gene name
Glb1, AW125515, Bge, Bgl, Bgl-e, Bgl-s, Bgl-t, Bgs, Bgt, C130097A14Rik
Definition
(RefSeq) galactosidase, beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00511  Other glycan degradation
mmu00531  Glycosaminoglycan degradation
mmu00600  Sphingolipid metabolism
mmu00604  Glycosphingolipid biosynthesis - ganglio series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    12091 (Glb1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    12091 (Glb1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    12091 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    12091 (Glb1)
   00511 Other glycan degradation
    12091 (Glb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    12091 (Glb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12091 (Glb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     12091 (Glb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12091 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 12091
NCBI-ProteinID: NP_033882
MGI: 88151
Ensembl: ENSMUSG00000045594
Vega: OTTMUSG00000062516
UniProt: P23780 Q3TAW7
Position
9 F3; 9 64.4 cM
AA seq 647 aa AA seqDB search
MLRVPLCTPLPLLALLQLLGAAHGIYNVTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFR
IPRFYWEDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLEKQSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGP
IITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTLQDLYAT
VDFGTGNNITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNLLAR
GANVNLYMFIGGTNFAYWNGANTPYEPQPTSYDYDAPLSEAGDLTKKYFALREVIQMFKE
VPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPFNGVRDRAYVSVDGVPQGILDRNLMTALNIRGKAGATLDILVE
NMGRVNYGRFINDFKGLISNMTINSTVLTNWTVFPLNTEAMVRNHLWGREASDEGHLDGR
STSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQ
KTLFVPRNILTTSAPNNITVLELEFAPCSEGTPELCTVEFVDTPVIS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggtccccctgtgtacgccgctcccgctcctggcactgctgcaactgctgggc
gctgcgcacggcatctataatgtcacccagaggacatttaagctcgactacagccgggac
cgcttcctcaaggatggacagccattccgatacatctcgggaagcattcattacttccgg
ataccccgcttctactgggaggaccggctgctgaagatgaagatggctgggctgaatgct
atccagatgtacgtgccctggaacttccatgaaccccaaccaggacaatatgagttttct
ggggaccgtgatgtggagcatttcatccagctggctcatgagctgggactcctggtgatc
ctgaggcctgggccctacatctgtgcagagtgggacatggggggcttacctgcttggcta
ctagagaaacaatctatcgttctccggtcttctgacccagactaccttgtagctgtggat
aaatggctggcagtccttctgcccaagatgaagcccctgctctaccagaacggaggaccg
atcataaccgtgcaggttgagaatgagtacgggtcctactttgcctgcgattacgactac
ctacgcttcctggtgcaccgcttccgctaccatctgggtaatgacgtcattctcttcacc
accgacggagcaagtgaaaaaatgctgaagtgtgggaccctgcaggacctgtacgccaca
gtggattttggaacaggcaacaatatcacacaagctttcctggtccagaggaagtttgaa
cctaaaggacctttgatcaattctgagttctatactggctggctagaccactggggtaaa
ccccattccacggtgaaaactaaaacactggctacctccctctataacctgcttgcccgt
ggggccaacgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggt
gccaacacgccctatgagccacagcccaccagctatgactacgacgccccactgagcgag
gctggggacctcactaagaagtattttgctcttcgagaagtcattcagatgtttaaagaa
gtcccagaaggccctatccctccgtctacacccaaatttgcatatggaaaagttgctctg
agaaagttcaagacagtggctgaagctctgggtatcctgtgtcccaatgggccagtgaaa
agcctctatcccctgacattcactcaggtaaaacagtattttgggtatgtgctgtaccga
acaacgcttcctcaagattgcagtaacccgaaacccattttctcttcacccttcaatggt
gtccgtgatcgggcttacgtctctgtggacggggtcccccaaggaatccttgatcgaaac
ctcatgacagctctgaacatacgggggaaggctggagccacgctggacatcctggtggag
aacatggggcgtgtgaactatggcagattcatcaatgacttcaagggtttgatttccaac
atgactatcaactccactgtcctcaccaactggacggtcttcccactgaacactgaggcc
atggtacgcaaccatctctggggccgggaggccagtgatgagggtcaccttgacggacgg
tcgacctccaattcttcggacctcatactccccaccttttacgtgggcaacttctccatc
ccctcgggcatcccagacctgccacaggacaccttcatccagtttcctgggtggtccaag
ggtcaagtatggatcaatggctttaacctcggccgatactggcccacaatgggcccacaa
aagaccttgttcgtgccaaggaacatcctgaccacttcagccccaaacaacatcacagtg
ttggagctagagtttgcaccctgcagcgaggggaccccagagctgtgtacagtagagttt
gttgacactccggtcatttcctga

DBGET integrated database retrieval system