KEGG   Mus musculus (mouse): 12091Help
Entry
12091             CDS       T01002                                 

Gene name
Glb1, AW125515, Bge, Bgl, Bgl-e, Bgl-s, Bgl-t, Bgs, Bgt, C130097A14Rik
Definition
(RefSeq) galactosidase, beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00511  Other glycan degradation
mmu00531  Glycosaminoglycan degradation
mmu00600  Sphingolipid metabolism
mmu00604  Glycosphingolipid biosynthesis - ganglio series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    12091 (Glb1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    12091 (Glb1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    12091 (Glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    12091 (Glb1)
   00511 Other glycan degradation
    12091 (Glb1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    12091 (Glb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     12091 (Glb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12091 (Glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 12091
NCBI-ProteinID: NP_033882
MGI: 88151
Ensembl: ENSMUSG00000045594
Vega: OTTMUSG00000062516
UniProt: P23780 Q3TAW7
Position
9 F3; 9 64.4 cM
AA seq 647 aa AA seqDB search
MLRVPLCTPLPLLALLQLLGAAHGIYNVTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFR
IPRFYWEDRLLKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVI
LRPGPYICAEWDMGGLPAWLLEKQSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGP
IITVQVENEYGSYFACDYDYLRFLVHRFRYHLGNDVILFTTDGASEKMLKCGTLQDLYAT
VDFGTGNNITQAFLVQRKFEPKGPLINSEFYTGWLDHWGKPHSTVKTKTLATSLYNLLAR
GANVNLYMFIGGTNFAYWNGANTPYEPQPTSYDYDAPLSEAGDLTKKYFALREVIQMFKE
VPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPFNGVRDRAYVSVDGVPQGILDRNLMTALNIRGKAGATLDILVE
NMGRVNYGRFINDFKGLISNMTINSTVLTNWTVFPLNTEAMVRNHLWGREASDEGHLDGR
STSNSSDLILPTFYVGNFSIPSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQ
KTLFVPRNILTTSAPNNITVLELEFAPCSEGTPELCTVEFVDTPVIS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgctccgggtccccctgtgtacgccgctcccgctcctggcactgctgcaactgctgggc
gctgcgcacggcatctataatgtcacccagaggacatttaagctcgactacagccgggac
cgcttcctcaaggatggacagccattccgatacatctcgggaagcattcattacttccgg
ataccccgcttctactgggaggaccggctgctgaagatgaagatggctgggctgaatgct
atccagatgtacgtgccctggaacttccatgaaccccaaccaggacaatatgagttttct
ggggaccgtgatgtggagcatttcatccagctggctcatgagctgggactcctggtgatc
ctgaggcctgggccctacatctgtgcagagtgggacatggggggcttacctgcttggcta
ctagagaaacaatctatcgttctccggtcttctgacccagactaccttgtagctgtggat
aaatggctggcagtccttctgcccaagatgaagcccctgctctaccagaacggaggaccg
atcataaccgtgcaggttgagaatgagtacgggtcctactttgcctgcgattacgactac
ctacgcttcctggtgcaccgcttccgctaccatctgggtaatgacgtcattctcttcacc
accgacggagcaagtgaaaaaatgctgaagtgtgggaccctgcaggacctgtacgccaca
gtggattttggaacaggcaacaatatcacacaagctttcctggtccagaggaagtttgaa
cctaaaggacctttgatcaattctgagttctatactggctggctagaccactggggtaaa
ccccattccacggtgaaaactaaaacactggctacctccctctataacctgcttgcccgt
ggggccaacgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggt
gccaacacgccctatgagccacagcccaccagctatgactacgacgccccactgagcgag
gctggggacctcactaagaagtattttgctcttcgagaagtcattcagatgtttaaagaa
gtcccagaaggccctatccctccgtctacacccaaatttgcatatggaaaagttgctctg
agaaagttcaagacagtggctgaagctctgggtatcctgtgtcccaatgggccagtgaaa
agcctctatcccctgacattcactcaggtaaaacagtattttgggtatgtgctgtaccga
acaacgcttcctcaagattgcagtaacccgaaacccattttctcttcacccttcaatggt
gtccgtgatcgggcttacgtctctgtggacggggtcccccaaggaatccttgatcgaaac
ctcatgacagctctgaacatacgggggaaggctggagccacgctggacatcctggtggag
aacatggggcgtgtgaactatggcagattcatcaatgacttcaagggtttgatttccaac
atgactatcaactccactgtcctcaccaactggacggtcttcccactgaacactgaggcc
atggtacgcaaccatctctggggccgggaggccagtgatgagggtcaccttgacggacgg
tcgacctccaattcttcggacctcatactccccaccttttacgtgggcaacttctccatc
ccctcgggcatcccagacctgccacaggacaccttcatccagtttcctgggtggtccaag
ggtcaagtatggatcaatggctttaacctcggccgatactggcccacaatgggcccacaa
aagaccttgttcgtgccaaggaacatcctgaccacttcagccccaaacaacatcacagtg
ttggagctagagtttgcaccctgcagcgaggggaccccagagctgtgtacagtagagttt
gttgacactccggtcatttcctga

DBGET integrated database retrieval system