KEGG   Mus musculus (mouse): 12095Help
Entry
12095             CDS       T01002                                 

Gene name
Bglap3, AI461847, Bglap-rs1, OC-X, ORG, mOC-X
Definition
(RefSeq) bone gamma-carboxyglutamate protein 3
  KO
K22609  osteocalcin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    12095 (Bglap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_TDP
Motif
Other DBs
NCBI-GeneID: 12095
NCBI-ProteinID: NP_001292377
MGI: 88155
Ensembl: ENSMUSG00000074489
Vega: OTTMUSG00000022057
UniProt: P54615
Position
3 F1; 3 38.81 cM
AA seq 95 aa AA seqDB search
MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDP
LEPTRELCELDPACDELSNQYGLKTAYRRIYGITI
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctctctctgctcactctgctggccctggctgcgctctgtctctctgacctc
acagatgccacgcccaccggccctgagtctgacaaagccttcatgtccaagcaggagggc
aataaggtagtgaacagactccggcgctaccttggagcttcagtccccagcccagatccc
ctggagcccacccgggagctatgtgagcttgaccctgcttgtgacgagctatcaaaccag
tatggcttaaagaccgcctacagacgcatctacggtatcactatttag

DBGET integrated database retrieval system