KEGG   Mus musculus (mouse): 12111
Entry
12111             CDS       T01002                                 

Gene name
Bgn, BG, DSPG1, PG-S1, PGI, S, SLRR1A
Definition
(RefSeq) biglycan
  KO
K08118  biglycan
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12111 (Bgn)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    12111 (Bgn)
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9 LRR_5
Other DBs
NCBI-GeneID: 12111
NCBI-ProteinID: NP_031568
MGI: 88158
Ensembl: ENSMUSG00000031375
Vega: OTTMUSG00000017659
UniProt: P28653 Q3TNY9
Position
X A7.3; X 37.33 cM
AA seq 369 aa
MCPLWLLTLLLALSQALPFEQKGFWDFTLDDGLLMMNDEEASGSDTTSGVPDLDSVTPTF
SAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYAL
VLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVF
SGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHN
KIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDL
KLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRL
AIQFGNYKK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtgtcccctgtggctactcaccttgctgctggccctgagccaggccttgccctttgag
cagaagggtttctgggacttcaccttggatgatgggctgctcatgatgaatgatgaggag
gcttcaggttcagacaccacttcaggtgtccccgacctggactctgtcacacctaccttc
agtgccatgtgtcctttcggttgccactgccacctgcgggttgttcagtgctctgacttg
ggtctgaagactgtgcccaaggagatctcacctgacaccacactgctagacctgcagaac
aatgacatttctgagcttcgcaaggatgacttcaaaggcctccagcacctctacgccctg
gtcttggtaaacaataagatctccaagatccatgagaaggcctttagccctctgcggaag
ctgcaaaaactctacatctccaagaaccacctggtggagattcctcccaacctgcccagc
tccctggtagaactacgaatccatgacaaccgtatccgcaaagtgcccaagggcgtgttc
agcgggctccggaacatgaactgcattgagatgggcgggaatcccctggagaacagtggc
tttgaaccaggagcctttgatggcctgaagctcaattacctgcgcatctcagaggccaag
ctcactggcatccccaaagatctccctgagaccctgaacgaacttcacctggaccacaac
aaaatccaggctattgagttggaggacctacttcgatactccaagctgtacaggttgggc
ttaggtcacaatcagattcggatgattgagaatgggagcctgagttttctgcctaccctg
agggaacttcacttggacaacaacaagctgtcccgggtgcctgctggcctcccagatctc
aagctcctccaggttgtctatctgcactccaacaacatcaccaaggtgggcatcaatgac
ttctgtcctatgggcttcggagtcaagagggcctactataatggcatcagcctcttcaac
aaccctgtgccctactgggaagtgcagcctgccaccttccgctgcgttactgaccgcctg
gccatccaatttggaaattataagaagtag

DBGET integrated database retrieval system