KEGG   Mus musculus (mouse): 12124
Entry
12124             CDS       T01002                                 

Gene name
Bik, Biklk, Bl, Blk, Nb, Nbk
Definition
(RefSeq) BCL2-interacting killer
  KO
K18452  Bcl-2-interacting killer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    12124 (Bik)
SSDB
Motif
Pfam: bcl-2I13
Other DBs
NCBI-GeneID: 12124
NCBI-ProteinID: NP_031572
MGI: 1206591
Ensembl: ENSMUSG00000016758
UniProt: O70337
Position
15; 15 E1
AA seq 150 aa
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGD
EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW
VSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcggaggcgagacttatggccagagacgtcatcaagactgttccacacgaccaggtc
ccccaacctccagtggcctctgagactcccagcatgaaggagcctgtgagagacgtggac
ctcatggagtgcgtggaaggcagaaaccaggtggccttgaggctggcctgcatcggcgat
gagatggacctgtgtctgcggagcccccgtctggtccagctgcctgggattgctatacac
agactcgctgtcacctacagccggacaggtgtcagaggtattttcaggagcttgattcga
agcctcaccaacctcagggaaaacatctggtcctggagagtcttgactcctggcgcctgg
gtgtcacctgaccaggaccctgggcagctgtttccgatggtgctgctggtcttcttgctg
ctgggtggggcctggtatttgcagcttcagtga

DBGET integrated database retrieval system