KEGG   Mus musculus (mouse): 12140
Entry
12140             CDS       T01002                                 

Symbol
Fabp7, B-FA, B-FABP, BFA, BFABP, Bl, Blbp, MRG
Name
(RefSeq) fatty acid binding protein 7, brain
  KO
K08756  fatty acid-binding protein 7, brain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    12140 (Fabp7)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 12140
NCBI-ProteinID: NP_067247
MGI: 101916
Ensembl: ENSMUSG00000019874
Vega: OTTMUSG00000035387
UniProt: P51880
Position
10; 10 B4
AA seq 132 aa
MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKN
TEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQKWDGKETNCTREIKDGKMVVTLTF
GDIVAVRCYEKA
NT seq 399 nt   +upstreamnt  +downstreamnt
atggtagatgctttctgcgcaacctggaagctgacagacagtcagaattttgatgagtac
atgaaagctctgggcgtgggctttgccactaggcaagtgggaaacgtgaccaaaccaact
gtgattatcagtcaggaaggtggcaaagtggtgatccggacacaatgcacattcaagaac
acagagatcaatttccagctgggagaagagtttgaagaaaccagcatagatgacagaaac
tgtaagtctgtggttcggttggatggagacaagctcattcatgtgcagaagtgggatggc
aaagaaacaaattgtaccagagaaattaaggatggcaagatggtcgtgactcttaccttt
ggggatatcgttgctgttcgctgttatgaaaaggcatag

DBGET integrated database retrieval system