KEGG   Mus musculus (mouse): 12142Help
Entry
12142             CDS       T01002                                 

Gene name
Prdm1, Blimp-1, Blimp1, PRDI-BF1, ZNFPR1A1, b2b1765Clo
Definition
(RefSeq) PR domain containing 1, with ZNF domain
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 SET zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 12142
NCBI-ProteinID: NP_031574
MGI: 99655
Ensembl: ENSMUSG00000038151
Vega: OTTMUSG00000035215
UniProt: Q60636
Position
10 B2; 10 23.24 cM
AA seq 823 aa AA seqDB search
MLDLLLEKRVGTTLAAPKSSSGSVKFQGLAETGIMKMDMEDADMTLWTEAEFEEKCTYIV
NDHPWDSGADGGTSVQAEASLPRNLLFKYAANNSKEVIGVVSKEYIPKGTRFGPLIGEVY
TNDTVPKNANRKYFWRIYSREEFHHFIDGFNEEKSNWMRYVNPAHSAREQNLAACQNGMN
IYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTVINLTQTESNPKQYSSEKNELYPK
SVPKREYSVKEILKLDSNPSKRKDIYRSNISPFTLEKDMDGFRKNGSPDMPFYPRVVYPI
RAPLPEDFLKASLAYGMERPTYITHSPLPSSTTPSPPASSSPEQSLKSSSPHSSPGNTVS
PLAPGLPEHRDSYSYLNVSYGSEGLGSYPGYAPAPHLPPAFIPSYNAHYPKFLLPPYGIS
SNGLSTMNNINGINNFSLFPRLYPVYSNLLSGSSLPHPMLNPASLPSSLPTDGARRLLPP
EHPKEVLIPAPHSAFSLTGAAASMKDESSPPSGSPTAGTAATSEHVVQPKATSSVMAAPS
TDGAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERP
FKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCK
VCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLKVHLKGNCPAGPAAGLPLED
LTRINEEIERFDISDNADRLEDMEDSVDVTSMVEKEILAVVRKEKEETSLKVSLQRNMGN
GLLSSGCSLYESSDLSLMKLPHSNPLPLVPVKVKQETVEPMDP
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcttctcttggaaaaacgtgtgggtacgaccttggctgcccccaagtctagc
tccggctccgtgaagtttcaaggactggcagagactgggatcatgaaaatggacatggag
gacgctgatatgactttgtggacagaggccgagtttgaagagaagtgtacatacatagtg
aacgaccacccctgggattccggcgctgacgggggtacttctgttcaagccgaggcatcc
ttaccaaggaacctgcttttcaagtatgctgccaacaacagcaaagaggttattggcgtg
gtaagtaaggagtacataccgaagggaacacgctttggacccctcatcggtgaagtctac
actaatgacacagttcccaagaatgccaacaggaagtatttttggcggatctattccaga
gaggagttccaccacttcattgatggctttaatgaggagaaaagcaactggatgcgctac
gtgaatccagctcactctgcccgggagcaaaacctggctgcctgtcagaacgggatgaac
atctacttctacactattaagcctatccctgccaaccaggaacttcttgtgtggtattgt
cgggactttgcggagaggctccactacccttatcctggagagctcacagtgataaatctc
acacaaacggaaagcaacccaaagcaatacagtagtgagaaaaatgaactctacccaaag
agtgtccccaagagagagtacagcgtgaaagaaattctaaaactggactccaatccctcc
aaaaggaaggacatctaccgttccaacatttcacccttcactttagaaaaggacatggat
ggctttcggaaaaatgggagccccgacatgcccttctaccctcgggtggtttatcctatc
cgggcacctctgccagaagactttttgaaagcgtccctggcctatgggatggagagaccc
acctacataactcacagtccccttccgtcttccacaactccaagtccccctgcgagcagc
agcccggagcagagccttaagagctccagcccccacagcagcccgggaaacacggtgtca
cccctggcgccaggcctcccagaacaccgggactcctactcctacttgaatgtttcctat
ggttccgagggcctgggctcctaccctggctatgcacctgccccccacctcccaccagct
ttcattccttcttacaatgctcactaccccaagttcctgttgccaccgtacggcattagt
tccaatggcttgagcaccatgaacaacatcaatggtatcaacaacttcagcctcttccct
aggttgtatcccgtctacagtaacctccttagtggcagcagcctgcctcatcccatgctc
aatccagcttccctaccgagttccctgcctaccgatggagcccggaggctgcttccaccg
gagcaccccaaagaggtgcttatcccagcaccccacagtgccttctcccttaccggggct
gcagccagcatgaaggacgagagtagtccccccagcggatctccaacggcgggaactgca
gccacgtcagaacacgtggtacaacccaaagctacctcatcagtgatggcggcccccagc
actgacggagccatgaatctcattaaaaacaaacgaaacatgactggttacaagactctt
ccttaccctctgaagaaacagaatggcaagatcaagtatgagtgcaatgtctgtgccaag
acgttcggtcagctctccaacctgaaggtccacctgagagtgcacagtggagaacggcct
ttcaagtgccagacctgcaacaagggttttactcagctcgcccacctgcagaaacactac
ttggtacacacaggagagaagccacatgagtgccaggtctgccacaagagatttagcagc
acaagcaatctcaagacccaccttcgattgcattctggagaaaaaccttaccaatgtaag
gtgtgccctgccaagtttacgcaatttgtgcacctgaagctgcacaagcgactgcatacc
cgggagcggcctcacaagtgtgcccagtgtcacaagagctacatccatctctgcagcctc
aaggtccacctgaagggcaactgccctgcgggcccagctgctgggctgcctttggaggat
ctgacccgaatcaatgaagaaattgagaggttcgacatcagcgacaatgcagaccgtctt
gaggacatggaggacagtgtcgatgtgacctccatggtggagaaggagattctagctgtg
gtcagaaaagagaaagaagaaaccagtctgaaagtgtctttgcaaagaaacatggggaac
ggcctcctctcctcagggtgcagcctctatgagtcatcggacctgtccctcatgaagttg
cctcacagcaacccactacctctggtgcctgtaaaggtcaaacaagaaacagttgaaccg
atggatccttaa

DBGET integrated database retrieval system