KEGG   Mus musculus (mouse): 12143Help
Entry
12143             CDS       T01002                                 

Gene name
Blk
Definition
(RefSeq) B lymphoid kinase
  KO
K08890  B lymphoid tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12143 (Blk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12143 (Blk)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   12143 (Blk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase SH3_16
Motif
Other DBs
NCBI-GeneID: 12143
NCBI-ProteinID: NP_031575
MGI: 88169
Ensembl: ENSMUSG00000014453
UniProt: P16277
Structure
PDB: 

Position
14 D1; 14 33.25 cM
AA seq 499 aa AA seqDB search
MGLLSSKRQVSEKGKGWSPVKIRTQDKAPPPLPPLVVFNHLAPPSPNQDPDEEERFVVAL
FDYAAVNDRDLQVLKGEKLQVLRSTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDITTQGEVVKHYKIRSLDNGG
YYISPRITFPTLQALVQHYSKKGDGLCQKLTLPCVNLAPKNLWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTRE
PIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANI
LVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYNDIITECWRGRPEERPTFEFL
QSVLEDFYTATEGQYELQP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgagcagcaagaggcaggtcagtgagaagggcaagggctggagccccgtg
aagatccgcacccaggacaaggctcccccacccctgccacccctggttgtcttcaaccac
cttgccccaccatctcctaaccaggacccagatgaagaggagcgttttgtggtggctctg
tttgactatgccgctgtgaatgacagggaccttcaggtgctgaagggtgagaagctccag
gtcttgaggagcactggagactggtggttggccaggtcactcgtcacaggaagagaaggt
tatgtgcccagcaactttgtggccccagtagagactctggaagtagaaaaatggttcttc
aggaccatcagccggaaggatgctgagaggcagttgctggctccgatgaacaaggccggc
tcctttctcatcagagagagtgagagcaataaaggtgccttttccctgtccgtgaaagat
atcaccacccagggggaggtggtcaagcactataagatccgatcactggacaatggaggc
tattacatctccccccggatcacctttcccaccctccaggccctggtgcagcactattca
aagaaaggggatggtttgtgtcagaagttgactctgccctgtgtgaacctggccccgaag
aacctttgggcccaagatgaatgggaaatccccaggcagtctctcaagttggtccggaaa
cttgggtctgggcagtttggcgaagtctggatgggttattacaaaaataacatgaaggtg
gccatcaagaccctgaaggagggaaccatgtcaccggaagctttcctgggcgaggccaac
gtgatgaaaaccctgcagcatgagaggctggttcgtctctacgctgtggtcaccagagag
cccatttacatcgtcactgaatacatggccagaggatgcttgctggattttctgaagacc
gatgaaggtagcaggttgtcccttccaaggctgattgacatgtcagcccaggttgcagag
gggatggcttacatagagcgcatgaattccatccaccgtgacctgcgggcagccaacatc
ctggtgtctgagacgttgtgctgcaaaatcgctgacttcggcttggccaggatcattgac
agtgaatacactgcccaagagggggccaagttccccatcaagtggaccgccccggaggcc
atccacttcggggtgtttaccatcaaggctgatgtgtggtccttcggagtcttgctgatg
gagattgtcacctatgggcgcgttccctacccaggaatgagcaaccctgaggtcatccgt
agcctggagcacggctaccgaatgccatgcccggagacatgtccaccggagttgtacaat
gatatcatcactgagtgctggcggggccggccagaggagcggcctacctttgagttcctg
cagtcggtgttggaggacttctacacagccacggagggccaatatgagctgcagccctag

DBGET integrated database retrieval system