KEGG   Mus musculus (mouse): 12160Help
Entry
12160             CDS       T01002                                 

Gene name
Bmp5, AU023399, se
Definition
(RefSeq) bone morphogenetic protein 5
  KO
K04663  bone morphogenetic protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12160 (Bmp5)
   04390 Hippo signaling pathway
    12160 (Bmp5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12160 (Bmp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12160 (Bmp5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12160 (Bmp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 12160
NCBI-ProteinID: NP_031581
MGI: 88181
Ensembl: ENSMUSG00000032179
Vega: OTTMUSG00000021529
UniProt: P49003 Q3UXE6
Position
9 D; 9 42.34 cM
AA seq 454 aa AA seqDB search
MHWTVFLLRGIVGFLWSGWVQVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMASEDNPEESEYLVRVSLAGEAKETRKGYPASP
NGYAHRLHLPPRTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDKGNHRFENETIKISIYQIIKEYTNRDADLFLLDTRKT
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRHGPQSKQPF
MVAFFKASEVLLRSVRAASKRKNQNRNKSNSHQDPSRMPSAGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcattggactgtatttttacttaggggtattgtgggcttcctctggagcggctgggtt
caagtgggttatgcaaaaggaggcttgggagacaatcacgttcactccagttttatttat
agaaggctacggaaccatgagagacgggaaatacagagggaaattctgtctattttgggt
ttgcctcacagacccaggcccttttcaccagggaaacaagcatcttctgcccccctcttt
atgctggatctctacaatgccatggctagcgaagacaaccctgaggagtcggagtatttg
gtgagggtgtccctggctggagaggccaaagagacaagaaagggatacccagcctctccc
aatgggtatgcgcatcgtctgcacttaccaccaaggactcctctgactacccagagccca
cctcttgccagcctacatgataccaactttctgaatgatgctgacatggtcatgagcttt
gtcaacttagttgaaagagacaaggacttttctcatcagaggaggcattacaaagagttt
cggtttgatctgacccagattccacatggagaagcagtgacagcagcagaattccggatt
tataaggacaagggaaaccatcgatttgaaaatgaaacaattaagatcagcatatatcag
atcatcaaggaatacacaaacagggatgcagatctttttctgctagatacgaggaagaca
caagctttagatgtgggctggcttgtctttgatatcactgtgaccagcaaccactgggtg
attaatccacagaacaatttgggcttacagctctgtgcagagacgggggatggccgcagc
atcaatgtaaaatctgctggtcttgtgggaagacatgggcctcagtcaaaacagccattc
atggtggccttcttcaaggcaagcgaggtacttcttcgatccgtgagagcagccagcaaa
cggaaaaatcaaaaccgcaataaatccaactctcatcaggacccctccaggatgcccagt
gctggagattataataccagtgaacaaaaacaagcctgcaagaagcacgaactctatgtg
agtttccgagatctgggatggcaggactggatcatagcaccagaagggtatgctgcattt
tattgtgacggggaatgttcttttccacttaatgcccatatgaatgccaccaaccatgcc
atagtccagaccctggtacacctgatgtttccagaccatgttcccaagccttgctgcgct
ccaaccaaactaaatgccatctcggtcctgtattttgatgacagctccaatgtcattttg
aaaaagtacagaaatatggtagtacgttcgtgtggctgccactag

DBGET integrated database retrieval system