KEGG   Mus musculus (house mouse): 12161
Entry
12161             CDS       T01002                                 
Symbol
Bmp6, D13Wsu115e, Vgr1
Name
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12161 (Bmp6)
   04390 Hippo signaling pathway
    12161 (Bmp6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12161 (Bmp6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    12161 (Bmp6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:mmu04052]
    12161 (Bmp6)
Cytokines and neuropeptides [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12161 (Bmp6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 12161
NCBI-ProteinID: NP_031582
MGI: 88182
Ensembl: ENSMUSG00000039004
Position
13:38529098..38684283
AA seq 510 aa
MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSSS
SGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVLPPQQQQQQQQQQTARE
EPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGVGQEPGSHGGASSSQLRQPSPGAAHSL
NRKSLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPHQRHHKEFKFNLS
QIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEE
GWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRAAGLVGRDGPYDKQPFMVAFF
KVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKHELYVSFQD
LGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKL
NAISVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgcccgggctggggcggagggcgcagtggctgtgctggtggtgggggttgctgtgcagc
tgcggccccccgccactgcggccccctctgccggtagccgcggccgccgccggggggcag
ctgctgggagccggcgggagcccggtgcgcgctgagcagccaccgccacagtcctcttct
tcgggcttcctctatcggcggctcaagacccacgagaagcgggagatgcaaaaggagatc
ctgtcggtgctggggctcccgcacaggccgcggcccctgcacggtctccagcagcctcag
cccccggtgctcccgccacagcagcagcagcagcagcagcagcagcagacggcccgcgag
gagccccctccagggcggctgaagtccgctccactcttcatgctggatctctacaacgcc
ctgtccaatgacgacgaagaggatggggcatcggagggtgtggggcaagagcctgggtcc
cacggaggggccagctcgtcccagctcaggcagccgtctcccggcgctgcacactccttg
aaccgcaagagtctcctggccccgggacccggtggcggtgcgtccccactgactagcgcg
caggacagcgctttcctcaacgacgcggacatggtcatgagctttgtgaacctggtggag
tacgacaaggagttctccccacatcaacgacaccacaaagagttcaagttcaacctatcc
cagattcctgagggtgaggcggtgacggctgctgagttccgcgtctacaaggactgtgtg
gtggggagttttaaaaaccaaacctttcttatcagcatttaccaagtcttgcaggagcat
cagcacagagactctgacctatttttgttggacacccgggtggtgtgggcctcagaagaa
ggttggctggaatttgacatcacagcaactagcaatctgtgggtggtgacaccgcagcac
aacatggggctccagctgagtgtggtgactcgggatggactccacgtcaacccccgtgcg
gcgggcctggtgggcagagacggcccttacgacaagcagcccttcatggtggccttcttc
aaggtgagcgaggtccacgtgcgcaccaccaggtcagcctccagtcggcggcggcagcag
agtcgcaaccggtccacccagtcgcaggacgtgtcccggggctccggttcttcagactac
aacggcagtgagttaaaaacagcttgcaagaagcatgagctctatgtgagcttccaggac
ctgggatggcaggactggatcattgcacccaaaggctacgctgccaactactgtgatgga
gagtgttccttcccactcaacgcacacatgaatgccaccaaccacgccattgtacagacc
ttggtccaccttatgaatcccgagtacgtccccaaaccatgctgcgcaccaaccaaactg
aatgccatctcggttctttacttcgatgataactccaatgtcatcttgaaaaagtacagg
aatatggtcgtgagagcttgtggttgccattaa

DBGET integrated database retrieval system