KEGG   Mus musculus (mouse): 12162Help
Entry
12162             CDS       T01002                                 

Gene name
Bmp7, OP1
Definition
(RefSeq) bone morphogenetic protein 7
  KO
K16621  bone morphogenetic protein 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12162 (Bmp7)
   04390 Hippo signaling pathway
    12162 (Bmp7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12162 (Bmp7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    12162 (Bmp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12162 (Bmp7)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12162 (Bmp7)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12162 (Bmp7)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Morphogens
   12162 (Bmp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 12162
NCBI-ProteinID: NP_031583
MGI: 103302
Ensembl: ENSMUSG00000008999
Vega: OTTMUSG00000016684
UniProt: P23359
Position
2 H3; 2 95.54 cM
AA seq 430 aa AA seqDB search
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASL
QDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYI
RERFDNETFQITVYQVLQEHSGRESDLFLLDSRTIWASEEGWLVFDITATSNHWVVNPRH
NLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHLRSIRSTGGKQRSQ
NRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEG
ECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgcgctcgctgcgcgctgcggcgccacacagcttcgtggcgctctgggcgcct
ctgttcttgctgcgctccgccctggccgatttcagcctggacaacgaggtgcactccagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgggagatcctgtcc
atcttagggttgccccatcgcccgcgcccgcacctccagggaaagcataattcggcgccc
atgttcatgttggacctgtacaacgccatggcggtggaggagagcgggccggacggacag
ggcttctcctacccctacaaggccgtcttcagtacccagggcccccctttagccagcctg
caggacagccacttcctcactgacgccgacatggtcatgagcttcgtcaacctagtggaa
catgacaaagaattcttccaccctcgataccaccatcgggagttccggtttgatctttcc
aagatccccgagggcgaagcggtgaccgcagccgaattcaggatctataaggactacatc
cgggagcgatttgacaacgagaccttccagatcacagtctatcaggtgctccaggagcac
tcaggcagggagtcggacctcttcttgctggacagccgcaccatctgggcttctgaggag
ggctggttggtgtttgatatcacagccaccagcaaccactgggtggtcaaccctcggcac
aacctgggcttacagctctctgtggagaccctggatgggcagagcatcaaccccaagttg
gcaggcctgattggacggcatggaccccagaacaagcaacccttcatggtggccttcttc
aaggccacggaagtccatctccgtagtatccggtccacggggggcaagcagcgcagccag
aatcgctccaagacgccaaagaaccaagaggccctgaggatggccagtgtggcagaaaac
agcagcagtgaccagaggcaggcctgcaagaaacatgagctgtacgtcagcttccgagac
cttggctggcaggactggatcattgcacctgaaggctatgctgcctactactgtgaggga
gagtgcgccttccctctgaactcctacatgaacgccaccaaccacgccatcgtccagaca
ctggttcacttcatcaacccagacacagtacccaagccctgctgtgcgcccacccagctc
aacgccatctctgtcctctacttcgacgacagctctaatgtcatcctgaagaagtacaga
aacatggtggtccgggcctgtggctgccactag

DBGET integrated database retrieval system