KEGG   Mus musculus (mouse): 12166Help
Entry
12166             CDS       T01002                                 

Gene name
Bmpr1a, 1110037I22Rik, ALK-3, ALK3, AU045487, BMPR-1A, BMPR-IA, Bmpr, SKR5
Definition
(RefSeq) bone morphogenetic protein receptor, type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12166 (Bmpr1a)
   04390 Hippo signaling pathway
    12166 (Bmpr1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12166 (Bmpr1a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12166 (Bmpr1a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12166 (Bmpr1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12166 (Bmpr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12166 (Bmpr1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12166 (Bmpr1a)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   12166 (Bmpr1a)
CD molecules [BR:mmu04090]
 Proteins
  12166 (Bmpr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 12166
NCBI-ProteinID: NP_033888
MGI: 1338938
Ensembl: ENSMUSG00000021796
Vega: OTTMUSG00000036087
UniProt: P36895 Q53Z43
Position
14 B; 14 20.81 cM
AA seq 532 aa AA seqDB search
MTQLYTYIRLLGACLFIISHVQGQNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVVLISMAVCIVAMIIFSSCFCYKHYC
KSISSRGRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDIPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctatacacttacatcagattactgggagcctgtctgttcatcatttctcat
gttcaagggcagaatctagatagtatgctccatggcactggtatgaaatcagacttggac
cagaagaagccagaaaatggagtgactttagcaccagaggataccttgcctttcttaaag
tgctattgctcaggacactgcccagatgatgctattaataacacatgcataactaatggc
cattgctttgccattatagaagaagatgatcagggagaaaccacattaacttctgggtgt
atgaagtatgaaggctctgattttcaatgcaaggattcaccgaaagcccagctacgcagg
acaatagaatgttgtcggaccaatttgtgcaaccagtatttgcagcctacactgccccct
gttgttataggtccgttctttgatggcagcatccgatggctggttgtgctcatttccatg
gctgtctgtatagttgctatgatcatcttctccagctgcttttgctataagcattattgt
aagagtatctcaagcaggggtcgttacaaccgtgatttggaacaggatgaagcatttatt
ccagtaggagaatcattgaaagacctgattgaccagtcccaaagctctgggagtggatct
ggattgcctttattggttcagcgaactattgccaaacagattcagatggttcggcaggtt
ggtaaaggccgctatggagaagtatggatgggtaaatggcgtggtgaaaaagtggctgtc
aaagtgttttttaccactgaagaagctagctggtttagagaaacagaaatctaccagacg
gtgttaatgcgtcatgaaaatatacttggttttatagctgcagacattaaaggcactggt
tcctggactcagctgtatttgattactgattaccatgaaaatggatctctctatgacttc
ctgaaatgtgccacactagacaccagagccctactcaagttagcttattctgctgcttgt
ggtctgtgccacctccacacagaaatttatggtacccaagggaagcctgcaattgctcat
cgagacctgaagagcaaaaacatccttattaagaaaaatggaagttgctgtattgctgac
ctgggcctagctgttaaattcaacagtgatacaaatgaagttgacatacccttgaatacc
agggtgggcaccaagcggtacatggctccagaagtgctggatgaaagcctgaataaaaac
catttccagccctacatcatggctgacatctatagctttggtttgatcatttgggaaatg
gctcgtcgttgtattacaggaggaatcgtggaggaatatcaattaccatattacaacatg
gtgcccagtgacccatcctatgaggacatgcgtgaggttgtgtgtgtgaaacgcttgcgg
ccaatcgtgtctaaccgctggaacagcgatgaatgtcttcgagcagttttgaagctaatg
tcagaatgttgggcccataatccagcctccagactcacagctttgagaatcaagaagaca
cttgcaaaaatggttgaatcccaggatgtaaagatttga

DBGET integrated database retrieval system