KEGG   Mus musculus (mouse): 12167
Entry
12167             CDS       T01002                                 

Gene name
Bmpr1b, AI385617, ALK-6, AV355320, Acvrlk6, Alk6, BMPR-1B, BMPR-IB, CFK-43a, SKR6
Definition
(RefSeq) bone morphogenetic protein receptor, type 1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12167 (Bmpr1b)
   04390 Hippo signaling pathway
    12167 (Bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12167 (Bmpr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12167 (Bmpr1b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    12167 (Bmpr1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12167 (Bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12167 (Bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12167 (Bmpr1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12167 (Bmpr1b)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   12167 (Bmpr1b)
CD molecules [BR:mmu04090]
 Proteins
  12167 (Bmpr1b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp FTA2
Other DBs
NCBI-GeneID: 12167
NCBI-ProteinID: NP_001264145
MGI: 107191
Ensembl: ENSMUSG00000052430
Vega: OTTMUSG00000025350
UniProt: P36898 B2RRZ4
Structure
PDB: 
3EVS

Position
3; 3 H1
AA seq 502 aa
MLLRSSGKLNVGTKKEDGESTAPTPRPKILRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKDRDFVD
GPIHHKALLISVTVCSLLLVLIILFCYFRYKRQEARPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEIARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCMKKLRPSFPNRWSSDECLRQMGKLMTECWAQNPAS
RLTALRVKKTLAKMSESQDIKL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgctcttacgaagctctggaaaattaaatgtgggcaccaagaaggaggatggagagagt
acagcccccacccctcggcccaagatcctacgttgtaaatgccaccaccactgtccggaa
gactcagtcaacaatatctgcagcacagatgggtactgcttcacgatgatagaagaagat
gactctggaatgcctgttgtcacctctggatgtctaggactagaagggtcagattttcaa
tgtcgtgacactcccattcctcatcaaagaagatcaattgaatgctgcacagaaaggaat
gagtgtaataaagacctccaccccactctgcctcctctcaaggacagagattttgttgat
gggcccatacaccacaaggccttgcttatctctgtgactgtctgtagtttactcttggtc
ctcattattttattctgttacttcaggtataaaagacaagaagcccgacctcggtacagc
attgggctggagcaggacgagacatacattcctcctggagagtccctgagagacttgatc
gagcagtctcagagctcgggaagtggatcaggcctccctctgctggtccaaaggacaata
gctaagcaaattcagatggtgaagcagattggaaaaggccgctatggcgaggtgtggatg
ggaaagtggcgtggagaaaaggtggctgtgaaagtgttcttcaccacggaggaagccagc
tggttccgagagactgagatatatcagacggtcctgatgcggcatgagaatattctgggg
ttcattgctgcagatatcaaagggactgggtcctggactcagttgtacctcatcacagac
tatcatgaaaacggctccctttatgactatctgaaatccaccaccttagacgcaaagtcc
atgctgaagctagcctactcctctgtcagcggcctatgccatttacacacggaaatcttt
agcactcaaggcaagccagcaatcgcccatcgagacttgaaaagtaaaaacatcctggtg
aagaaaaatggaacttgctgcatagcagacctgggcttggctgtcaagttcattagtgac
acaaatgaggttgacatcccacccaacacccgggttggcaccaagcgctatatgcctcca
gaagtgctggacgagagcttgaatagaaaccatttccagtcctacattatggctgacatg
tacagctttggactcatcctctgggagattgcaaggagatgtgtttctggaggtatagtg
gaagaataccagcttccctatcacgacctggtgcccagtgacccttcttatgaggacatg
agagaaattgtgtgcatgaagaagttacggccttcattccccaatcgatggagcagtgat
gagtgtctcaggcagatggggaagcttatgacagagtgctgggcgcagaatcctgcctcc
aggctgacggccctgagagttaagaaaacccttgccaaaatgtcagagtcccaggacatt
aaactctga

DBGET integrated database retrieval system